KEGG   Puccinia graminis: PGTG_13407Help
Entry
PGTG_13407        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pgr  Puccinia graminis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PGTG_13407
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PGTG_13407
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PGTG_13407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 841 aa AA seqDB search
MSRSMIDHVQVPAQLKAGTLMLKVSAKKTIKTNVSLEYERGQIVWETKKGGSLNIESVRE
IRFGQDASYYRTQFKLSPELEGRWLTIIYLSKKSTYKMLHLIACDPDTFALWKETLLRIL
AFRRELLGGLNHMRKRQDYWLKQNWSQGDSTEDAKLDFQEIVNLCRKLNISVPQSDIQAH
FDIADSQKRGYLDFPAFQHFVKLMKRRPDLESLFQQFTSGRAVMSVDEFTRFMQNVQHSE
LTPSTIHAIYTKFLDDDNDDDREREARELNPTKQMTIEGFASFLQSADNAALHEKHTAVH
QDMSLPLHDYFISTSHNTYLVGNQLKGESTVEGYIRALQHGCRSVELDCWDGDAGEPVIY
HGRTLTRKLQLSEALKAISKHAFVASPYPLILSLEVHCQPAQQERLAELLKTCLGEALVD
RPLENLSSESLPSPKDLMYRILVKAKKPIVGGDGPRSTEIYSNFDSSATSTTSGSSTSSD
SDLKRRISNASTVLGERFKRIASAMSIPSPPVERSLPTTTDQSPTLTGQSGSAALIPGPS
VGSLAPPPSKIPTAPLTNSLSSLIVYTVGVKARGFNKLTTYEKEHILSLSERTVNKFLKA
GPLRMLDLIQHNRSHLTRAYPAATRVFSSNFLPHRFWAVGLQLVACNWQTHDLAMELNSA
FFDQNGRSGYLLKPLALRVKGKEKDAATKMHKYQLDITIISIQQLPKLTIEDDNAGIDPC
VEVQLISPVPNSSCTSPPQSTKRRTKVVKGNGFNPVYHEEFKIQFQTPGEMVDLCFLRLL
VIDAGQGSGNGAKEEDGLVGKVCVCLGGLQPGYRHLPLHDDSGQQLLFASIFINSSLSKL
P
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctcgatgatcgatcatgtccaggtgcctgcccagctcaaggcgggcacgctg
atgctcaaggtatccgcaaagaagaccatcaagaccaacgtctcactcgagtacgaacgc
ggccagatcgtttgggagaccaagaagggcggctctctcaacatcgaatccgtcagggag
atcagattcggccaggatgcctcctactaccgcacccaattcaaactgagcccagagctc
gaaggacgctggctgacgatcatctatctgtccaagaagtcgacctacaagatgctccat
ctcatcgcctgcgaccccgacactttcgccctgtggaaggaaaccctcctgcgaatcctg
gccttcagacgcgaactgctcggcggcctgaaccatatgcgcaagcgacaagactattgg
cttaaacagaattggtcccagggcgatagcactgaagatgccaaattggacttccaagag
atcgtcaacctatgtcgcaagctcaacatctctgttccccagtccgacatccaggcccat
ttcgatattgccgactcgcaaaaacgcggctatctcgacttcccggccttccaacacttc
gtcaagctcatgaagagacgccccgatctcgagtctctcttccaacaattcacctccggg
agagcggtcatgagcgtggacgagttcactcgattcatgcagaacgtccaacactctgaa
ttgacgccttcgacgatccacgcgatctacaccaagtttttggacgacgataatgatgat
gatagagagagggaagcccgggagcttaatccgacaaagcagatgacgatcgaaggcttt
gcgagctttctccaatccgccgataacgcggcccttcacgagaaacataccgccgttcat
caagacatgtccctacctctccacgattattttatctctacctcccacaatacttatctg
gtcggcaatcagctcaagggagaaagtaccgtcgaaggctacattcgcgccttacaacac
ggatgtcgaagtgtcgaacttgattgctgggatggagatgccggggagccggtgatctat
cacggccgaaccctaacgaggaagctacagttatcagaagcattgaaggcgatctccaag
cacgcctttgtcgcctcgccctaccccttgattttgtccttggaggtccattgtcagccc
gctcaacaggaacgtcttgccgaacttttgaagacttgtctgggcgaagctttggtcgat
cgacctcttgaaaatctctcctccgagtccttgcctagtcctaaagacttgatgtatcgc
atattggtcaaggctaagaaaccaatagtaggaggagatggcccaaggtcgactgagata
tattccaatttcgatagctcggccacctctacaacatccggctcatctacgagttcagat
tcggacttgaagcgcagaatctccaacgcatcgacagtattgggcgaacggttcaagcgt
attgcctcagcgatgtcgatcccgagtccgccggtcgagaggtcgctgcccacgacgacc
gaccagtcgccgacgttgactgggcagtccggctcggcggccctgatcccgggaccaagc
gtgggctcgttagctcctccaccttcgaagatcccgacggcgccactgacaaacagtctt
tcgagtctgatcgtttataccgtcggcgtcaaggcgcgcgggttcaataaactgacgacg
tacgagaaggagcatatcttgtcgctctccgaacggaccgtcaataagttcctcaaagca
ggcccgctcagaatgttggacctcatccaacacaaccgctcccatcttactcgcgcctat
cccgccgccactcgggtctttagctcgaacttcttgccccataggttctgggccgtcggc
ctccaattggtcgcttgtaactggcaaactcatgatctcgccatggaacttaactcggcc
ttcttcgatcaaaacggacgctcgggatatctcctcaaaccgttggcgctgagggtcaag
ggcaaagagaaagatgcggcaacgaagatgcataagtatcagttagacatcactatcatc
tcgatccaacaattacctaagctgacgatcgaggacgacaatgctgggatcgatccctgc
gtcgaagtccaactcatctcgcccgtccctaattcctcctgcacttcgcccccgcaatct
actaaacgaaggactaaggtcgtcaagggcaacgggtttaatccagtgtatcatgaagaa
ttcaagatccaattccagacgcccggcgagatggtagacctatgtttcttgaggttattg
gtcatcgatgccggccagggcagtggaaatggagccaaagaagaggacggattggtgggc
aaagtgtgtgtctgtttaggcgggctccaaccaggttatcgccatctacctctccatgac
gattccggccaacagctcctgttcgcctcgatcttcatcaactcttctctctccaagctc
ccctga

DBGET integrated database retrieval system