KEGG   Puccinia graminis: PGTG_13786Help
Entry
PGTG_13786        CDS       T02226                                 

Definition
histidinol dehydrogenase
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
pgr  Puccinia graminis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pgr00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 889 aa AA seqDB search
MVLFAHIPFLPYLDDPTRIPSREILIQLQTIVPILISAVHAAEILALLPAQVETYIYDDL
DPVDLPEADRLETLIMLLDRGSSKVISQASFVKPLLERGVPHNRIIPRFSSSSSPQNLDH
LSDLSSSSSGNPQSVMLEIPHNSDSDLSTSTTTLEKFLDFIDHQSKDHPTFLLDPHRQLE
SLLSSSSSSKRTTEELNVVQLIGSTDLIKMDSEQLIEQFLKSLKTDRPDGLYTTSVVSDS
PACSLLGQVYSSLESIKKSIQTRKATYYSRSRSQLWIKGETSGATQECLRIRTDCDRDSL
EFHVIQKPLTGFCHTQEISCFGPLGGLKQLESTLLHRLQTSTPGSYTNRLFNDEKLLRAK
IMEEAEELCDAESPSDLTGEMADLLYFALCRCISKGVSLAQVEQKLNQRALKVTRRKGDA
KPKWEAKINDGAKEDQRANPAPKPTPAEGPLRCQMIDLKEVPEQERASLLKRPMTDSRTM
TGLVTPIIEMVKTRGDQGLLEAVQKFDRCGFESADQLTIRAPFAESSMQISPEIKQAIDV
AYNNIYKFHEKQLEKERTPMVVETMKGVVCSRFVRPIDRVGLYVPGGTAILPSTALMLAI
PAQVAGCEAISIATPARADGTISAEIMYIAQKCGVQEIVKAGGAHAIAALAYGTQRVSKV
DKIFGPGNQFVTVAKMLVASDVHAATAIDMPAGPSEVLLIADRSCEPVFVAADLLSQAEH
GIDSQVILLAIDLKAEQLQEIQNQINLQAHRLSRIEIIKQSIPKSFIVQVPTLDAAFQLS
NHYAPEHLILHIKDPNQASHLIRNAGSVFIGPFSPESCGDYASGTNHSLPTVGFAKQYSG
VSTMSFMKHITTQELTKDGLKELGPTVIRLANLEGLDGHANAVQVRLLQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattcgcgcacatcccatttctaccatatctcgatgatccgacgaggataccg
agccgggagatcctgatccaactgcagacgatcgtccccatcctgatctcagccgtccac
gccgccgagatcttggccctcttgcccgcccaagtcgagacctacatctacgacgatctc
gaccctgtcgatctgcccgaagctgaccggttggagactctcatcatgctcctcgatcgt
gggtcttctaaagtgatctcccaagcatccttcgtcaaacccttactcgaacgaggcgtc
ccccacaaccgcatcatcccgcgcttctcttcttcttcttctccccaaaatctcgatcat
ctttccgatctctcatcgtcgtcatccggaaatcctcagtctgtcatgctcgaaatccct
cataactcggactctgatttatcgacttcaactaccactttggagaaatttctcgacttc
atcgatcatcaatctaaagatcacccaacttttctcttagaccctcaccggcaattggaa
agtttactatcatcatcatcatcatcgaagaggacgacggaagaactgaacgtggttcag
ttaattggatcgacagatctgatcaagatggattccgagcaattgatcgagcaatttctg
aagagtttgaaaacggatcgcccggatggattatacacgacctcagtcgtgagcgactcg
ccggcatgcagtctcctgggccaagtatattcctcgctcgagtcgatcaagaagagcatc
cagacccggaaggctacatactatagtcggtcgaggagccagctttggatcaagggagaa
accagtggggccacccaggaatgtctgcggattcggacggattgcgatcgcgattctctg
gagtttcacgtgattcaaaagccgttgaccgggttctgtcatacccaagaaatcagctgc
tttggcccgctaggcggcctcaaacagctcgaatctaccttgcttcaccggctccaaact
tcgactcctggcagttataccaaccgattattcaacgatgagaagctattacgcgcgaag
atcatggaggaagccgaagagctatgtgatgctgaatccccctcagacctgacgggagag
atggcagacttgctctacttcgctctatgtcgatgtatcagtaagggagttagtctggcc
caagtcgaacagaagctcaaccaacgtgcgctcaaagtgactcgaaggaagggggatgcc
aagccgaaatgggaggccaagatcaatgacggagccaaggaggatcaacgagcgaatccg
gcgcccaagccaaccccagcagagggcccgctacgttgtcaaatgatcgatctgaaagaa
gtgcccgaacaggaacgggcctcgttactcaaacgcccgatgacggactctcggacgatg
acaggactggtgaccccgatcatcgaaatggtcaagactaggggcgatcaaggacttttg
gaggccgtccaaaaattcgacagatgcgggtttgagagtgccgatcagttgacgatccgg
gccccgttcgccgaatcctcgatgcagatctcccccgaaatcaagcaggcaatcgatgtg
gcctacaacaatatctacaagttccacgagaagcagttggagaaggagcggacgccgatg
gtagtcgagacgatgaagggcgttgtctgttctcgattcgtccgcccgatcgatcgggtt
gggctttatgttccaggcgggaccgcgattcttccgtcgacggccttgatgctagcgatt
ccggcgcaagtggcgggatgtgaagcgatcagcattgcgacgccagcacgagcggatggg
acgatctcggcggagatcatgtacatagcccagaagtgtggggtgcaggagattgtgaag
gcgggaggagcacatgcgattgcggccttagcctatggcacccaacgggtctccaaggtc
gacaagatcttcggcccggggaaccagttcgtgacggtggccaagatgctggtggccagt
gatgtgcatgctgcgacggcgatcgacatgcctgcggggccctcggaggtcctactgatc
gccgatcgatcctgcgagccggtctttgtggccgccgatcttctctctcaagccgaacat
gggatcgactcgcaagtcatcttacttgctatcgatctcaaagccgagcaacttcaagag
atccaaaatcaaatcaatcttcaagctcatcgactctctagaatcgaaatcatcaaacaa
tcgatccctaagagcttcatcgttcaggtgcctacccttgatgccgcctttcagctcagc
aatcattacgctcctgaacaccttatcttgcatatcaaagaccccaaccaagcctctcat
cttattcgcaacgctgggagcgtctttattggccccttttctcctgaaagctgtggtgat
tacgcgtcgggtacaaaccattcattacctactgtgggatttgcaaaacagtattcagga
gtgtcgacgatgagttttatgaaacatatcaccactcaagagttgactaaagacggatta
aaagagttgggaccgacggtgattaggttggctaatcttgaaggcttggatgggcatgcg
aatgccgttcaagttcgactgcttcaataa

DBGET integrated database retrieval system