KEGG   Puccinia graminis: PGTG_13814Help
Entry
PGTG_13814        CDS       T02226                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pgr  Puccinia graminis
Pathway
pgr04011  MAPK signaling pathway - yeast
pgr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PGTG_13814
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PGTG_13814
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PGTG_13814
Protein kinases [BR:pgr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PGTG_13814
Chromosome and associated proteins [BR:pgr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PGTG_13814
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGTG_13814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 Haspin_kinase S_100 APH
Motif
Other DBs
NCBI-GeneID: 10535069
NCBI-ProteinID: XP_003332429
UniProt: E3KUR0
AA seq 416 aa AA seqDB search
MAAAVALPSSATGGATLPGSGPTVANTSTNNNNNPAGNASSTTTTSNTTAPAQKPASSRT
PAEPRRVRFNVGSKYHVMDVIGEGAYGVVCSAVHRPTGQKVAIKKITPFDHSMFCLRTLR
ELKLLKYFQEQNVSENIISIVDIIRPPSIEAFKEVYLIQELMETDMHRVIRTQDLSDDHC
QYFIYQTLRALKALHSADVIHRDLKPSNLLLNANCDLKVCDFGLARSVRTAEQETGFMTE
YVATRWYRAPEIMLTFKQYTKAIDVWSVGCILAEMLSGRPLFPGRDYHHQLTLILDVLGT
PSLDEFYAINSRRSRDYIRALPFRKKRPFNVLYPNASALAIDFLTKTLTFDPKKRLSVEQ
ALQHPYLEAYHDPDDEPVAPPLDEDFFAFDRQKDEISKEELKQLLFDEIASFHSTA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccgtagctcttcccagctcggccaccggcggagcaacgctccccggctcg
ggccccaccgtcgccaacacctccactaacaacaacaacaatccggccggcaatgcttcc
tccactacaaccacttccaacactactgcgccggcccaaaaaccggccagctctcgcacg
cccgccgagcccagaagggtccgattcaacgtcggctcaaaatatcatgtcatggatgtc
atcggtgagggcgcttatggcgtcgtctgctctgccgtccatcgtcctaccggccaaaaa
gtcgccatcaagaagatcactcccttcgatcattcgatgttctgtcttagaactttgcgc
gaattgaagttgctcaaatacttccaggaacaaaatgtgtccgaaaacatcatctcgatt
gtcgatattattcgacctccctcaattgaggcgttcaaggaagtgtatttgatccaggaa
ctgatggagacggacatgcaccgggtgataaggacgcaagacctctcggacgaccattgc
caatacttcatataccagaccctgcgggcgctcaaagccttgcattcggccgacgtcatc
catcgcgacctcaagccctccaatctgctcctgaatgctaactgcgacctcaaggtgtgc
gactttggcttggcccgctccgtcaggaccgccgaacaagaaaccggattcatgaccgaa
tatgtggctactaggtggtatcgagcccccgaaatcatgcttaccttcaagcaatacacc
aaggccattgacgtctggtcagtgggctgcatcctagccgagatgctatcggggcgaccg
ttatttccgggacgagactaccaccaccaactgacgctgatcctggacgtgttggggacg
ccgtcgttggacgagttctatgcgatcaactcgcgccggtcgcgggactacatccgggcc
ttgccgttccgcaagaagcggcccttcaacgtgctctaccccaatgcctccgccctggct
atcgacttcctcaccaagaccctcaccttcgaccccaagaaaagactctccgtagagcag
gccctccagcatccgtacctcgaggcgtatcatgaccccgacgacgaacccgttgctccc
cctctcgacgaagacttcttcgccttcgatcgccagaaagacgagatcagtaaggaagaa
ctcaaacaactcttgttcgatgagattgccagcttccattctacagcgtag

DBGET integrated database retrieval system