KEGG   Puccinia graminis: PGTG_14121Help
Entry
PGTG_14121        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1220 aa AA seqDB search
MPWDPVSEKIWASLGVIRKEVSESLSDDSSPPPPVASATDHPKTSPSNPASSSVPSAQGP
TPLLVLPSLNVKTPEGRKNRAIWCRALLEISVFLKWYKLQHPHIEESIKSNYIVPFNLVS
AYPKIVQMLGGNSIPVFPTKSTWQTPNGKPVAYAAYAKLGIVPSVPDGVIISGYEVQVRT
FPHLRYEFYEALREIQMIRESQSLAVFLGIEASRGVVGLTEARLAWNLICGDGKDPSFDN
MDLTREDFMMNAYNAKEAAETNPAEKTKLRNALRTLVEANPTNELLRVISDTANSAAEEK
ANPMDLNKAYATLGDIIPEVDDEMLWMAYTIGVSDQPGQKDVLREALQVIARHRKSQLIE
SRLVAEIKGGNAESAMEIVPYSPPPVSYDLPAGLNNIGNTCYLNSLLQYFFSVRELREIL
LRFPEFEQDIDEHQEMKEKKRVGGRIVSASEILRSKQFASQLQGLFREMISTPLSAVTPE
RELAFLALVLSKDESPMSVPTTTTNANHNSSASTDATLVDDQPVILGPTFNATPSPPANV
ASAGSSTVLGKRKSESSGSDDGHSTSRNLMDVDSVPPATADKELIGPTKDLAMAGSSPIL
PTSEPDPPPPPKATAPLIIDLTDDSNNPPPPPPPPLPPRPNRSKSVTAIESGSHMMFGRQ
NDVSECMDNCLFQIQAALDQEKIRASGEFDGDGNLVKSLFYGKTRQSLMFENPKGKVSIK
EEQFAYLLVDVAEEGRDLYDGLDKVFDESEVELENGKACRRVGLVELPPILQIQLQRVQF
DRRTHTVFKSNAHLKFGQRLRMDRYLEPDPDDQVGQEKRTKTIGLRKEIECLRGRLGELT
TNVSGDKRTASTVLRDLHGILSSSADPSSCPSRAGSSPGTRLDFFHGLLGPEELDYLDAE
ATAIDAEIAGNKVAIKRLKAHVEEMWKVDETNENAPASRSEEFSPPSNTTAHLPPSLDHN
LPTKSSTTTTTTPTSTPVVPMNVEPSQSHLPPASGNLNKDKDRRLEQDDDDEPVIKDDRI
DKHPSSSSSQTAEYILVGLFMHRGTAQGGHYWAIQRQLPDRLDRWLKYNDSQVSEIDPKV
EVFNDDDEHADDDEEEGGETVGEQMVVEGPKARDEDDQTKTPPSTDLQLPHQIKPSSSGF
PASKNRQKRTADNANPYWLTYVRKDQLNRFQMVHRNLHAFDPPVVISSSATPPVLSSCSS
SSSAPLPPATLVPADPIVLS
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggacccagtctcggaaaagatatgggctagtttaggggtcatacgaaaagaa
gtgagcgagtctttatcagacgactccagtcccccacccccagtcgccagtgctaccgat
catcctaaaacctcgccctccaatcctgcctcatcttccgtcccttctgctcagggacca
accccgttattggtccttcctagtcttaacgtcaagacccctgaaggaaggaagaatcgc
gcaatctggtgtagggctttgctcgagatctccgtcttcttgaaatggtataaattacaa
catcctcatatcgaagaatcgatcaaatcaaactatatcgtcccttttaatctcgtgtcg
gcttaccccaagatcgtccaaatgctaggagggaattcgatcccggtatttccaaccaag
tcgacgtggcaaaccccgaacggcaagccagtagcctatgcggcctacgctaaactaggg
atcgtcccgagcgtgccagatggggtgatcatctccggctacgaggtccaagtgcgcacg
ttcccccacctgcgttatgagttctacgaggcgcttcgggagatccagatgatccgggaa
agccaatctttggcggtattcttgggtatcgaggccagtcgaggcgttgtcggacttacc
gaagctagattggcttggaatttgatctgcggtgatggcaaagatccttcctttgataac
atggatcttactagagaagatttcatgatgaacgcgtataatgccaaagaagccgctgag
actaatccagctgagaaaacaaaacttcggaatgcgctcaggactttagtcgaggccaat
ccgaccaatgagcttttacgagtcatctcagataccgccaatagtgcggcagaagaaaag
gctaaccctatggacttgaacaaagcatatgccaccctaggtgatattatacccgaagtg
gatgacgagatgctgtggatggcttatacaattggcgtttctgatcaacctggtcagaaa
gacgtcttaagagaggccctccaagttattgctagacaccgaaagagtcaactaatcgag
tctcgtttggtcgccgaaattaagggtggtaatgctgaaagcgcaatggaaatcgttcca
tatagtcctccccccgtatcttatgacttgcctgctggactcaataatattggaaatact
tgctatttgaattctttgcttcagtattttttctcagttcgagaactgcgagaaatcttg
ctcaggtttcctgagttcgaacaggatatcgatgagcatcaggagatgaaggaaaagaaa
agagttggaggtcggatcgtctcggcctctgaaattttgcgctccaagcaatttgcctcc
cagttgcaaggcttgttccgagagatgattagcacaccattatcagccgtgacgccggag
agagagcttgcatttcttgcgctagttctatcgaaagatgagagcccgatgagtgtgcca
acgacgacgacgaatgcgaaccacaactcgtctgcgagtacggatgcgacgttagtggat
gaccagccggtgatacttggcccgaccttcaatgcgacgccctcgccaccggcgaatgtt
gcctcagcgggttcatcaaccgtcctaggcaaacggaagagcgagagcagcgggtcagat
gacggtcattcgaccagccggaacctcatggatgtcgactcggtcccccctgcgaccgct
gacaaggagcttattggacccactaaggacctcgccatggctggtagctcgcccatctta
cccacctccgaacctgacccacctcctccacctaaagctaccgcaccattgatcatcgac
cttaccgacgactccaacaaccctcctcctcctcctcctcctccccttccgccccgtccg
aatcggagcaaaagtgtgacagctattgagagtggatctcatatgatgtttggtcgtcaa
aacgacgtctccgagtgtatggataattgtctctttcagatccaggccgctcttgatcag
gagaaaattagggccagtggagagtttgatggggatggaaacctcgtgaaatcgttgttt
tatggcaaaactagacaatccttgatgtttgaaaatccgaaagggaaagtgtcaatcaag
gaagaacagtttgcttatttgctggtcgatgtggctgaggaaggtcgagatctttacgat
ggattggataaagtatttgatgagagtgaggtagagttagagaatgggaaagcttgtcga
cgagtgggattggtagagttaccacctattcttcaaattcaactacagagggttcaattt
gatagaagaacacataccgtattcaagtcgaatgctcatctgaaattcggccaacgtctt
cgaatggaccggtacttagaacctgatccagatgaccaagtaggacaagagaagagaacc
aagaccattgggctgcggaaagagattgaatgtctgcgcggcaggttaggagaactaacg
acgaatgtgagtggagacaagcgcaccgccagcacagtcttacgggacctgcatggtatc
ttatcctccagcgcggatcccagtagttgtccgtccagggccggctcgagtcccgggact
cgactggacttcttccacggcttattaggccccgaggagctcgactatctggatgctgaa
gccactgcgatcgacgcggagatcgcgggtaataaagtggccatcaagcgtcttaaagca
catgtggaagagatgtggaaggtcgacgaaaccaacgagaatgcaccggcctctcggtct
gaggaattctctcctccttctaacaccaccgctcatctccctccctccctcgatcacaat
cttcccactaaatcttctactacgacaaccacgactcctacttctactcccgttgttccg
atgaatgtcgagccttctcagtcccatctcccccctgcttctgggaatctcaataaagat
aaagataggcggcttgagcaggatgatgatgatgagccggttatcaaagatgatcggata
gataaacatccgtcctcttcctcctctcaaactgccgaatatatcttggtcggcttattt
atgcatcgagggacggcacaggggggacattattgggcgattcaacgacaattaccggat
cgattggatcgatggttgaagtataatgacagccaagtgagcgagatcgatccgaaggtc
gaagtgttcaacgacgacgacgagcacgcggacgacgacgaagaagaaggaggcgagaca
gtcggagaacaaatggtagtagaggggcccaaagcgcgagacgaggatgatcagaccaag
acgcctccctcgaccgatctccaacttcctcatcaaatcaaaccttcttcgtctgggttt
ccggcgagtaagaatcgtcagaaaaggacggctgataatgccaatccttattggctgacg
tatgtgaggaaagaccagctcaatcgcttccaaatggtccatcgtaacctgcatgctttc
gatccacccgtcgtcatctcctcctctgctactccgcccgtcctttcttcttgctcttcc
tcttcttcggcccctcttcctcctgcgactcttgttcctgctgatcctatcgttctttct
tga

DBGET integrated database retrieval system