KEGG   Puccinia graminis: PGTG_14216Help
Entry
PGTG_14216        CDS       T02226                                 

Definition
amylo-1,6-glucosidase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pgr  Puccinia graminis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1608 aa AA seqDB search
MVGKQKPSSKQSIKSSSTLSSHPPPTSAESRSTAQSSPPNSRSAKAPQSSTPITVFELSL
QDDGSPSKEKSYIRLPSPVEPYLLRFSIAAGARASNSGTLYTNFPLEGHAFERKKFHTHS
LPQDTSQPIQIDLKVAQAGAFEFYVEFQGDSTKGEDRVKSKPGYFNVDPVLTAPARHKIL
SGELENQKILPVGEGGKVKKGSSANISLDGLVIQTVVAKWMGKMSGWPKYMDVIRDRGYN
MIHFTPLQARGESGSPYSIYDQLRFDPELFDQPPKSAEDEQKQLLDWLSRLRDEWGILSL
TDIVLNHTANNSPWLRDHPESGYNIVNSPHLEPALELDSALLELSDTLAKKSLPEALESE
VDLDRIIHFIEHQTLAQLKLWEYYVIDVDHVAAKFSQAWSSSEHPKSEGHSHIEWSEFEK
ACTEHEGSGWKQVTGPRGHISEKIDINSTVRLFQEKGYGCVSPEETMETLKRILNELNVE
RYQEYDDDVKAIIQNTRSRIRYTRLDPHGPKMGPITKKCPLIESLFTRLETDSKTKNHDP
KSLALANNGWIWNANPLEDFASEKSKAYLRREVIVWGDCVKLRYGQSPKDSPFLWDHMTK
YTELLARFFGGFRIDNCHSTPIHVGEYLLDVARRVRPDLYVCAELFTGSEDMDTYFVSRL
GINSLIREAMNGHDPKDQSRLLYNYGLGKPIGSMDTDCLTELSEVSFPSKSGDKSTVKCQ
IVPLHGSKPHAFLMDCTHDNESPADKRTARDAMPTGGLVPFAFSAIGSNKGFDDLYPKLL
DLVGEKRLYDHVEVEAGIGRWKRLLNHLHTEMAADDFKEGHFHQENDYIISHRVHPSTNE
GYLLVAHMAFHGDSNDRGFVEPMKLRRTKAAFIIGSTLEILSNKDPSDQTTLRGLDSKLT
PIAPDSPESFIRPGSDSDGDFVEIVVPQQFPPGSLMLFKTWMEGMKPEQSEMKGRNLESF
VGSGATEKFEGLNLVDLNLILYRTDGEERDSTGGRDGAYEVRGLGRNVYCGLEGWMHHLR
YIIRTNDLGHPLCAHLRDGPWPFEYVLERLRKNSQLSPNLSGPVEWLEERINLIKAKIPA
FMRPKYFALLIYTAYKASKERAIALCSPFIRQGTVFIHSLAMTAVQMYGLVPSASLDPKE
NLPCVAAGLPHFSSGWARTWGRDCAISASGLFIKTGLYEVARAHLLCFCTTLKHGLMPNL
LDSVRTPRYNSRDSPWFMLQLLQEYVKYSKEGEAILSVQVKRRFPSSDEWVPWDSPTAYS
ENITVGEVVEEILERHAKGIDFREYNAGPAIDGQMSDKGFNINIHVDWATGLVLGGNDKN
CGTWMDKMGESEKAGNKGFPGTPRDGAPVEIIGLLYSTLVWAGELAKAGKLRKQAVETEI
DGKKVKVTYDEWAQKIQKNFEKCYWIPLDSNEDKDFTIDPKLITRRGVYKDVFGTPSDRA
HADYQLRPNFPIAMAVAPKLFTPSRALIALKTAREALIGPLGMRTLDPWEADYRPDYDNA
NDSSDWHVAKGRNYHQGPEWVWPIGYYLRAFLHFDTLVGEGLKNRQATIHQIHSILAEHR
RYIQSDPWAGLPELTNKDGAFCRDSCESQAWSTSTILDVLFEIYHLDK
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atggttggcaagcagaagccatcttcaaaacagtcgatcaagtcgtcttccaccctttct
agtcatccccctcctacctcagcagaaagccgaagtactgcccagtcgtcacctccaaac
tcacgttcggccaaagctccgcaaagcagcaccccaatcacagtgtttgagctcagctta
caagatgatggatcaccatctaaagaaaaatcgtatatacgtttgccatcgccggtggag
ccgtatctactccgattctcaattgccgcgggggcacgtgcgtcgaattctgggacgcta
tacacgaactttcctctcgaaggacatgccttcgaacgcaagaagttccatacacattcg
cttccccaggatacttctcaacccatccagattgatttgaaagtagctcaagccggtgca
ttcgaattctatgtcgagttccaaggcgactcaaccaagggcgaggacagagtcaaaagt
aagccaggatatttcaatgtcgatcctgttttaacagctcccgctcgccacaaaatccta
tcgggggaactcgaaaaccaaaaaatcttacccgtcggagaaggcggcaaggtcaagaaa
ggctcttctgccaacatttctttggacggcttggtgattcagaccgtcgtcgcgaagtgg
atggggaaaatgagtggatggccgaaatacatggatgtgatcagagatcgtggctacaac
atgatccactttacacctctacaagcccgtggggaaagtggtagcccttatagtatttat
gatcagttacgatttgatccagagctatttgaccagcccccaaaatccgccgaagacgaa
cagaaacagcttttggattggttatcacgacttcgagatgaatggggaatattaagctta
accgatattgttttgaatcatacggccaacaacagtccgtggctgcgagatcatccagaa
tcaggctacaacatcgtcaactcgcctcacttggagccagctcttgaactagattcagct
ctgttagaattatcagataccttggccaagaaaagtcttcccgaggcgctagaatctgaa
gtagatctcgatagaattatacatttcatcgaacaccagaccttggcccaactcaagctc
tgggagtattatgtgattgacgtggatcacgttgccgccaaattctctcaagcttggtca
agctccgaacatcctaaatcggagggccactctcatatcgaatggtcggagtttgaaaag
gcctgtacagagcatgaaggaagtggctggaaacaggtaacaggacctcgtggccacata
tccgagaaaattgacataaattctacagttcgtctattccaagaaaagggatatgggtgc
gtgtcacctgaggaaacgatggagacgttgaaaagaatactcaatgaattgaacgttgag
cgctaccaagagtacgatgatgatgtaaaggcaatcattcaaaacactcgaagtcgaatt
cgctacactagactagatccgcacgggccgaaaatggggccgatcaccaaaaagtgtcct
ttgatcgaaagtttatttacacgtttggagacggactcgaaaacaaaaaatcacgacccc
aaatctctagccttggcaaataacgggtggatctggaacgccaatccattggaagatttt
gcctcagagaaatcgaaagcttatctgagaagggaggtgatcgtttggggtgactgtgta
aaattgcgatacggtcagagcccgaaagacagcccttttctttgggatcatatgacgaag
tacaccgaacttctagctcgcttttttggcgggtttagaatcgacaattgccactccaca
ccaattcatgtgggggagtacttattggatgttgcccgcagggttcggccagacttgtac
gtttgcgcggagttgttcaccggaagtgaagatatggacacgtactttgttagtcggctt
ggcataaacagtctaattcgggaggcaatgaatgggcatgaccctaaagatcagagtcga
cttctttacaactacggacttgggaagccgatcggctccatggatacggattgcttgacc
gagctgtcggaagtttcgttcccgtctaagagtggagataaatctacggtcaaatgccaa
atcgtgccgttacatgggtccaaacctcacgccttcttgatggattgtactcacgataac
gagtccccggccgataaaagaacagctcgagacgccatgcctaccggcgggcttgtgcca
tttgcgttttcggccatcggttcgaacaaaggtttcgatgatttgtacccgaagcttcta
gacttggttggtgaaaaaaggttgtatgatcatgtcgaggtcgaagccggaattggacga
tggaagcgattgctaaatcacctgcacacagaaatggctgcagacgacttcaaggaaggg
cattttcatcaggaaaatgactacattatatcgcatagagttcacccatccaccaatgaa
ggctacttgcttgttgcccatatggctttccatggtgattctaatgatcgcggctttgtg
gagcccatgaagctgcgccggacgaaagctgctttcataattggctcaactcttgagatc
ttgtccaacaaggacccatccgatcaaaccactctcagaggcctcgactcaaaactcaca
ccaatagcgccggactcgcctgaaagcttcataaggccagggtctgattctgatggagat
tttgtcgagattgtcgtacctcaacagttcccccctggtagtttgatgttgttcaaaact
tggatggagggaatgaagccggaacaaagcgagatgaaaggtcgaaacctggaatctttt
gtaggatcgggagcaacagagaaattcgagggacttaatctagtcgatttgaatctgatc
ttatacaggacagatggggaagaacgagactctactggaggtcgtgatggtgcatacgag
gtccgcggccttggtaggaacgtatattgcggcttagaaggatggatgcatcatctcagg
tacatcattcgcaccaacgacttgggccatcctctttgcgcccatttgagagatgggcct
tggccgtttgaatatgttctcgaaagattacgcaaaaattcccagctatcgccgaatctc
agtgggccagtggaatggcttgaagagagaataaatctcattaaagccaagattccagcc
ttcatgcgacccaagtacttcgccttattgatatatacggcttacaaagcaagtaaagaa
agagcgatcgctctatgctccccctttattcgtcaaggcacggttttcatccattcgttg
gccatgaccgctgtccaaatgtatggtttggtgccatccgcgtctttggacccgaaagag
aatcttccttgtgttgcggctggattgccacacttcagttcgggctgggcaaggacgtgg
ggccgggattgcgcaatcagcgcgagtggcttattcatcaagaccggtctatacgaagta
gctcgtgctcatctgttgtgcttctgtaccactttgaaacatggtttgatgccgaatcta
ctcgactctgtccgaactcctcgttataattctcgcgattcgccgtggtttatgctccag
cttttacaagaatacgtcaagtattctaaggaaggggaagcgatattgtcggttcaagtc
aaaagacgattcccgagttccgatgaatgggtaccctgggattctccgaccgcctattct
gaaaacatcacggtaggagaagtagttgaagaaattcttgagaggcatgctaaaggaatc
gactttcgcgagtacaacgcgggacctgctatcgatggtcaaatgagtgataaagggttc
aacataaatattcacgtcgactgggctactgggttggtattgggaggaaacgacaaaaat
tgcggaacttggatggacaaaatgggagagagtgaaaaggctgggaacaagggctttccc
ggaacacctagagatggggctccagtggaaataattggcttgctttatagcacgctggta
tgggcaggagaacttgcaaaggcagggaaactgcgaaagcaagctgtcgaaactgaaatc
gatgggaaaaaagtcaaggtcacttacgacgagtgggctcagaagatccaaaaaaacttt
gagaaatgctattggattccattagattccaacgaggataaggattttacgatcgatcca
aagttgataacacgccgtggagtctacaaggatgtgtttggtacaccttccgaccgagct
catgccgattaccaactgcgcccgaatttccctatagccatggcagttgcacccaagtta
ttcactccttctcgtgctttgatagctttgaaaacagctcgagaagctctgattggacct
cttggaatgcgcactttggatccctgggaagcggactaccgaccggactacgataatgca
aacgattcttcagattggcacgttgccaaggggagaaattatcatcaaggtcctgaatgg
gtctggcctataggctattatttgagggctttcttgcactttgacacattggttggggaa
ggtcttaagaaccgtcaagcaactattcaccaaatccattccatcttagctgagcatcgc
agatatatccaatcggatccttgggccggattgccagaattgaccaacaaagatggggcc
ttttgtcgtgatagctgtgaaagccaagcctggtcgacttcaacgattttggatgtgttg
tttgagatctaccatctcgacaaatga

DBGET integrated database retrieval system