KEGG   Puccinia graminis: PGTG_14341Help
Entry
PGTG_14341        CDS       T02226                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MAWRSHGTTNNQLIQNLFTNGLMKSHRILEAMKKVDRANYLIIPGSQKYAYEDRPQSIGF
GATISAPHMHANALENLLPFLKPGARVLDVGSGSGYMVACFHHLVKGPAPESSPPTIGFV
LGIEHIPELARQSIENLRKDGLGPSLENSEISVSSEDGRNPDLRHGGAWDVIHVGAAAPT
VPEALLNQLNAPGRMFIPVGEENQAIYQIDKHSDGRITQQELYGVRYVPLTDQKSQLNCD
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaggtctcatggcacaacaaacaaccaactcatccaaaacctgttcaccaat
ggattaatgaaatcacacaggatactcgaggcgatgaagaaggtcgatcgagccaattat
ctcatcatccctggctctcaaaagtatgcctacgaggaccggcctcaatccatcggattc
ggtgccaccatctcggctcctcatatgcatgcaaacgccctggagaacctactgccattc
ttgaaaccaggcgcaagagtactagatgtgggcagtggtagcggctacatggtagcctgt
tttcaccatctagtcaaagggccagcacccgagtcatccccgccgactattggcttcgtt
ctagggatcgagcatatccctgagctagcccgacaatcgatcgagaatcttaggaaggac
ggcttaggaccgagcctagagaattctgagatcagcgtctccagcgaggatggaaggaac
ccggatctaagacatggaggtgcatgggacgtcattcatgtcggcgctgctgccccaacg
gtcccagaagctttattgaatcaacttaatgcacctggaagaatgttcatacctgtcggt
gaagagaatcaagcgatttatcaaatcgataaacattccgatggaaggattacccaacaa
gagttgtatggggtcagatacgtccctctgaccgatcagaaatctcagctaaactgcgac
acttga

DBGET integrated database retrieval system