KEGG   Puccinia graminis: PGTG_14583Help
Entry
PGTG_14583        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_14583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MSFFNSASNNNTGVFGGGSSSTTVTTQDPKDIEVENPPTDGISSIAWSPQADFLAAGSWS
NEVRIYEVNGQGQSVPKAAYSHEQPVLEVIWSGDGTKIISGGCDRAARAYDVPTGQSTQV
AAHEAPIRKLAWLDINGQGLLATGSWDKTLKYWDLRQPTPAVSVTLPERIYTMDTVFPLM
VVGTAARKIHIYHLSNPSVEYKSLDSPLKWQTRCIACFNDAQGYAVGSVEGRVAIQHVED
KQTANNFSFKCHRKDAPTGASRLNANTIPQVWAVNDIKFHKQHGTFATAGSDGTINMWDK
DSKTRLKTFDNRGGPITSVSFNRTGTVFAYTVSYDWSQGHSGAQSTGAANPAAGTAASQP
NKIMLHALKDDEIKKRPKK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcttcaactcggcctcgaacaataataccggcgtattcggcggcggatcctcc
tctactaccgtcaccactcaagaccctaaagatatcgaggtcgaaaatcctccgacagat
ggcatctcttccatcgcgtggtcccctcaagctgatttcttggctgctggatcttggtca
aatgaagtacgaatatacgaagtgaatgggcaaggccaatcggtcccgaaagcggcatat
tcgcacgagcagccggtgttggaagtgatctggtctggggacgggacgaagataatctcg
gggggctgtgaccgggcggcgcgcgcctatgatgtgccgacgggccagtcgacccaagtg
gccgcacatgaggcgccgatccgaaagctggcctggctggatatcaatggccagggcctg
ctggccaccggcagttgggacaaaacgctcaagtattgggacttgcgtcagccgactccc
gcagtctccgtcacccttcccgaacgcatctatacgatggataccgtctttcctttgatg
gtcgtgggcaccgctgctcgtaaaattcatatctatcatttgagtaacccttcggttgaa
tataaatctctggactcgccgctaaaatggcagacacgatgtatagcctgtttcaatgat
gcgcaaggatacgcggttggaagtgtagaaggacgagtggcgatccaacacgtcgaggat
aaacagacagccaacaacttctcgttcaagtgtcatcggaaagatgctcccaccggcgcc
agtcgtctcaacgctaatactatccctcaggtctgggccgtcaacgatatcaagttccat
aaacagcatggtacttttgctaccgctggctctgatgggacgatcaatatgtgggataag
gacagcaagacgcgtctaaaaacatttgacaaccgaggcgggccgattacgagtgtatcg
ttcaaccgaacaggcacggtatttgcatacacggtctcctacgactggtcccaaggtcac
tcgggtgctcagtccactggagcggctaatcccgccgctggcaccgcggcttctcagcct
aataaaatcatgctacatgccttaaaagacgatgagattaagaaacggcctaagaaatga

DBGET integrated database retrieval system