KEGG   Puccinia graminis: PGTG_14774Help
Entry
PGTG_14774        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pgr  Puccinia graminis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PGTG_14774
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PGTG_14774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MYAGQAWEQQVHKRDRITTSGTMGDCQRACFIRSSINIDQYFTVGNIVRSGETISSRGFS
ERIGGKGANAAVAISKAGERVYFSGLIDNQSTWLKDTLKAFQVDVDGLKICDERSKLPTG
RAIIQVSHETGENAIVLVPGANHAPSEFWPELESILKPMKYSHVLLQNEIPIAQTLHTSK
IAHSLGITTIFNPSPLPSPKEVTEVIDWSCIDWLIVNEEEARMLRNRATSRTRCDDQLEC
GEIPDLKQELAVLQELISFSMATFSIVITLGSRGSLLAFRHTPSVWIGVHTPPSAGKRPV
INTTGAGDCFTGFLVAELIRLDKSPIPKDQLLERLKKSMQVASQAARLCVENHGTIDSYP
TLEEVQTHSNVCS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcgggccaagcttgggagcagcaagtacacaaacgagaccgaataacgaccagt
ggcacgatgggcgattgtcaaagagcttgttttatcaggagcagcatcaacatcgatcaa
tactttactgttggaaatattgtccggtcaggagaaacgatttcaagccgaggatttagt
gagaggatcggggggaagggagctaatgcagcggttgcgatttccaaagcgggagaacgt
gtctatttttctggactgattgacaatcagtcaacttggctaaaagatactttgaaggca
tttcaggttgatgttgatggattgaaaatctgcgatgaaagatcaaaacttccaactggc
cgagcaataattcaagtttctcatgagaccggcgaaaacgcaatcgttctggtcccagga
gccaaccatgcgccgtccgagttttggccagaacttgaatcaatactgaagccgatgaaa
tatagtcacgtattacttcaaaacgagatcccaatcgcccagactctccacacctcgaaa
atcgctcattcactaggcatcaccaccatcttcaatccatcaccactaccaagccccaag
gaagttacagaagtaatagattggagttgtatagattggctgatcgtcaacgaggaagag
gcacgaatgctaagaaatcgcgcaacttctaggactcgctgcgacgatcagcttgaatgc
ggagaaattcctgatttgaaacaagagctggcagttttgcaagagttaatcagtttttcg
atggccacgttttcaatcgtcataaccttgggctcacgtggctctttgctagcctttcga
catactccatccgtttggatcggcgttcatactcctcctagtgcaggaaagagaccggta
atcaatacaactggggctggagattgctttacaggttttctggttgcggaattgatcaga
ttggacaagagtccgatacctaaagatcagcttttagaaagattgaagaaatccatgcag
gtagctagccaagcagcccgtttgtgtgtggaaaaccacggaaccattgacagttatcca
acccttgaagaagtgcaaactcattcaaatgtttgcagctag

DBGET integrated database retrieval system