KEGG   Puccinia graminis: PGTG_14781Help
Entry
PGTG_14781        CDS       T02226                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pgr  Puccinia graminis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pgr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pgr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:pgr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MLKIYQATFIAHLALTGVWAHDNGLAITPPMGWNTWNKYGCNINEDLILSAAKAIKSEGL
DKLGYTYVNIDDCWQAPHRGPNNEPIADPEKFPSGIKHLSNQIHALGLKLGIYSDAGTYT
CGKRFGSLGYEINDAQAYADWGVDYLKYDNCYNEGLSGTPSISATRYRTMRNALNDTGRP
IVYSLCQWGEDQVWNWGATIANSWRISGDIYDNFDRPDDRCPCPDSSVPCPLAGFHCSVM
NILEKAAGLGQKAGPGGWNDLDMLEVGNGGMSYDEYVTHFSMWALVKSPLILGNDVTKMS
PETKSIISNKEVIAINQDAEHSAGYRVWKKPTPNGRQGNLQLWKSYLSHGEFVLAFINAS
PQQIGSYVISLSEFFIDEGQWPMSRTWTVKDLWNSTGATSIRQVHNAHNNQIPITMSSDY
KDLQLIVNNIPSNGIKLLKLTEQKPKSK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatctaccaggccaccttcatcgcacatctggcgctcactggggtctgggct
cacgataatggcttggcgatcacccctccaatgggctggaacacttggaacaagtatggc
tgtaatattaacgaagacttaattctttcagcggcaaaggcgattaaatccgagggactc
gataaattaggctacacttacgtcaatattgacgattgttggcaagcaccacatcgtggg
cctaacaacgagcctattgcggatcccgaaaaatttcccagtggcatcaaacatctcagc
aaccaaatccatgccctaggattgaaacttgggatatattcggatgctggaacctatacc
tgtggcaaacgttttggatcgcttggttacgaaattaacgatgcccaggcttatgctgat
tggggagtagattatttgaagtatgataattgttataacgaagggctttctggtacccct
agtatatccgcaactcgctacaggacgatgaggaatgcactcaacgacactggccgaccg
atcgtctattcgctctgccaatggggtgaagatcaagtctggaattggggtgccaccata
gcgaattcgtggagaatctcgggtgacatctatgacaactttgaccgaccggatgatcga
tgtccttgtccagattcatctgtcccatgtcctttggccggctttcattgttcggtcatg
aacatcttggagaaggccgctggtcttggtcagaaagcaggaccaggtggatggaatgat
ttggatatgctcgaggtcgggaatggtggaatgtcatacgacgaatatgtcacccatttc
tcaatgtgggctctcgtcaaatcgccgttgatcttgggcaacgatgttacaaaaatgtct
cccgaaaccaagtcgatcatcagcaacaaagaagtcattgccattaaccaggacgcagag
catagcgccggttatcgagtatggaagaaacctactcccaatggccgtcagggcaatctt
caactttggaaatcgtatctttctcatggggagttcgtcttggcctttatcaacgcctca
ccccaacaaatcggcagctacgtcatctccttatccgagtttttcattgacgagggtcaa
tggcctatgagtcgtacctggacagtcaaagatctatggaattcgaccggcgctacgtcg
atcagacaggttcacaatgctcataataaccaaatcccaatcaccatgtcttcagattac
aaagatcttcaattgatcgtcaataatatcccttctaatggaatcaaactcttgaaactc
acagagcaaaaaccgaaaagtaaatga

DBGET integrated database retrieval system