KEGG   Puccinia graminis: PGTG_14850Help
Entry
PGTG_14850        CDS       T02226                                 

Definition
glycosyl hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSCILGRRAFFGLLFYCSLVWLNYAAPWPDQTQHRVLVGTAVDRNFLKQPDYAQTVKKYF
KLITAQNEMKWQSLQAWPGDSGFTWDAADEIYSFVQNNNKLLRIHTLFAQGQYPTWVESM
SPQDLRNAMGKVIFNVIQRYYDRTIAIDVCNEIFNDQDGKMRDNTVWFRKLNEDFVNFAY
YTARQAGLLYNPKLLLYLNDYGIEGPGPKADAILHKAIELKGRGILDAVGFQCHFSVGKV
PQGMKENMKRFTDAGLKIAITELDIAIENVAANGASQAVLEQQAQDFKHVFDICQQLDGC
ISVTVWGVSPADSWIGKNDFAPGSGKAVLFDEGYKPSLALQQLPQALFENGN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcattctgggacgccgtgccttttttgggcttcttttctactgttcactggtc
tggttgaactatgcagctccttggccagatcaaacccagcaccgggtgctggtaggaaca
gcggtcgacagaaactttttgaagcaaccggattacgcgcaaacggtcaaaaagtatttc
aagctcataactgctcaaaatgagatgaaatggcagtcactgcaggcctggccaggcgat
agtggatttacatgggacgcggctgatgagatatacagctttgttcagaacaacaacaaa
ttacttcggatacatactctatttgctcaaggacaatatccgacatgggttgaatctatg
tcgccacaagacttaaggaatgctatgggcaaagtcatcttcaatgtaattcagcggtat
tatgatcggacaatcgcaatagatgtttgcaatgagatcttcaatgatcaagatggcaag
atgcgagataatacggtttggttccgcaagttaaatgaggactttgtcaattttgcatat
tacactgctaggcaagcgggcctgttatataaccccaaactgctgctctatttaaatgat
tatgggattgaaggtccaggcccaaaggcagatgcaattcttcacaaagctatcgagctt
aagggaagaggaattctggatgctgtaggattccaatgccatttttctgtaggaaaggtt
ccacaaggaatgaaggagaacatgaaacgttttacggatgcaggtttgaagatagcaatc
actgaactggatattgcaattgaaaatgtagctgccaatggagcatcccaagcagtgcta
gaacaacaagcccaggatttcaagcatgtttttgacatatgtcagcagctggatgggtgt
atatctgtaacagtctggggagtaagtcctgcagactcttggattggcaagaatgatttt
gcaccaggttctgggaaagctgtactatttgatgagggatataagcctagtcttgcatta
cagcaactcccacaagctctgtttgagaatgggaattag

DBGET integrated database retrieval system