KEGG   Puccinia graminis: PGTG_15366Help
Entry
PGTG_15366        CDS       T02226                                 

Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_15366
Translation factors [BR:pgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PGTG_15366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MAESATSPTFPSSQLPPVAALASSQAVRSALADYTQASSIPSSSVSSPQLDHSSSSEKED
QEEKDDQSSLEDGEIPTEPAGTSSSASNNPITIFSSQTEFNVKHPLYSTWTLWFDNATKN
DKAKNWDDLIQQVMQVESVEEFWGLYHNIVPPSLIHVGSNYYLFKEGIKPAWEDPANAKG
GSWSIQLSRDRSRDMIDKWWLYTMLAAIGETFETPYTANGKPPATMSFTDEVTGVVISAR
KMFFRISIWTRSADSKELAQNIGRHFKYGVLSIPETFRFAPSDGKSIQTDCEFRSHTDSQ
LKKKKPTFTV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgctaccagtcccaccttcccttcatctcaactaccgcccgtagccgcc
ctagcctcatcgcaagccgtccgaagtgcactagccgactatacccaagcctcctcgatc
ccatcctcatcagtctcatcaccacaactcgatcacagctcatcatccgagaaggaggat
caagaggagaaggacgaccaatcatccttagaggatggcgaaatccctaccgaaccagct
ggcacttcctcctccgcctccaacaatccgatcaccatcttcagctcccaaaccgaattc
aacgtcaaacatccgctctactctacgtggaccctctggttcgataacgctactaagaac
gataaggctaagaattgggacgaccttatccaacaggtcatgcaggtcgagagtgtcgaa
gaattttggggactatatcacaacatcgttccaccttcattaattcacgtcggatcgaac
tattacttattcaaagaaggaatcaagcccgcatgggaagatccagccaatgccaagggt
gggagctggagcattcaactgtcgcgcgatcggagtcgtgacatgatcgacaaatggtgg
ctgtacaccatgctagcggcgattggagagacgtttgagaccccatacacagcgaacggg
aagccgccggcgacgatgtccttcaccgacgaagtcacgggcgtcgtcatctcggcccgc
aagatgttcttccggatctcgatctggacgcgctcggccgactcgaaagaactggcccag
aacatcggccgtcacttcaaatacggcgtcctctcgatccccgaaaccttcagattcgct
ccctccgatggcaaatcgatccagaccgattgcgaattcagaagccataccgactcccaa
ctcaagaaaaagaaacctactttcactgtttaa

DBGET integrated database retrieval system