KEGG   Puccinia graminis: PGTG_15512Help
Entry
PGTG_15512        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PGTG_15512
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PGTG_15512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 720 aa AA seqDB search
MAHEKQNGTFTSNPHHAPPSTSLSRPSRTGICHSQQMLKHWKPDVQFDTIKDQDDENEEP
ERPSRIARIIAHVSKQKLTDNLEHIKIRKATKEEIMLVHSEGHWKRIEETATMSLQDLKD
RSAYFTRLSLYVNGDTFDCARLSCGGVIEMCRAVMDGKIKNGFAVVRPPGHHSEPEDPSG
FCVFNNAAISAKWLRTVYPDKVKKVLLVDWDVHHGNGIQRSFYYDSSVLYISIHRFLQEN
RSEYFYPGTDWGGSNRVGDGDGQGFNVNIPWPEGGMCDADYIYAFQRLVMPIAMEFDPDF
VIVSAGFDAAKNDPLGECNVTPEGFAHMTHMLTSLASGKTVLALEGGYHLESLALSATEC
IKVLMGEAPPKLGCAMVASDVATETVDECLKIQSAFWKSLPRQGLSAKYELEMDGLSIPL
GDVLKMHRSYDLYEAHGLCTIPSHDQQSSGLSKSYQNQIMVTDNVYDCKTLVLFMHDLGS
LRNEIFTESANLKDENEALIAYNKVLMDWIRKNGYGLIDVQVLPSYLSDLVLDGMAKKAE
QAKTVKRMVNWIWNQFISLSDCQNLILICLGEGCAALPVLFDIKDFSDKLKASVHIPSSR
QPPLVFPNDCNWHRAISAGFLGSTEEDRAKIQNTAKEYSYGKVSVSDKFRPSQILRSEWD
KITEFIHAKLAGDLPPNGPQTNGNTLSRRTSQIASNGRPIPNGTPNGLRSEPPALPMDLD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgagaagcagaacggaacattcacctcgaatcctcaccatgcccctccgtcc
acttcattgtccaggccatcccgcactgggatctgtcattctcagcagatgctcaaacat
tggaagcctgacgtccagttcgatacgataaaggatcaggacgacgagaatgaagaaccc
gaacggccctccagaatcgctaggattattgcgcatgtttcaaagcaaaaattgaccgat
aatttggagcacatcaaaattcgaaaggctaccaaggaagagatcatgttggttcatagc
gagggacattggaaacgaatagaggaaactgcaacaatgtcgctacaagatctaaaagat
cgctccgcgtattttacgcgtctgtcgctctacgtgaatggagacacgtttgattgtgcc
cgactatcctgtggaggagtgatcgagatgtgtcgcgcggtgatggacgggaaaattaag
aatggctttgccgtcgtccgaccccctggacaccattctgaacctgaagacccttcgggt
ttctgtgtctttaataatgccgccatctcggctaaatggctcagaacggtttatcctgat
aaagtgaagaaagtgctgctggtagattgggatgtgcatcatggaaacggaattcagcgg
tccttctactatgattcgagtgttttgtatatctctatccaccggttcctacaagaaaat
cggagtgaatacttctacccggggaccgattggggaggcagcaatcgagtgggagacggt
gatggtcaaggcttcaatgtcaatattccttggccggagggcggaatgtgcgacgccgat
tacatctacgctttccaacgtctcgtcatgcccatagccatggaatttgacccggacttt
gtcatcgtttccgccggatttgatgcggccaagaatgacccattgggggaatgtaacgtc
acacctgagggatttgctcacatgactcacatgctaacgtcactggcaagcggaaagacc
gtacttgcacttgagggtggttatcacctggaatctctggcattatcagctactgagtgc
atcaaagtcttgatgggtgaagcaccacccaagctgggctgtgcaatggttgctagtgat
gtagcaacagagaccgtagacgagtgcttgaaaattcaatcagcgttttggaaatcactg
cctcgacagggactctctgctaagtatgagcttgagatggatggactcagcattcctctc
ggggatgttctcaaaatgcatcgctcatatgatctatacgaagctcatggactgtgtacc
attccatcccatgaccaacaatcttctggcctctcaaaatcttaccagaatcaaatcatg
gtcacagataatgtttatgactgcaaaactctagtcttgttcatgcacgatctaggaagc
ctccggaatgaaatcttcacggaatcggcgaacctgaaagacgaaaatgaagcactcatc
gcatacaacaaggttctgatggactggatccggaagaatggatacggactgatcgacgtc
caagtcttgccctcgtatctctcagacctggtcctcgacggaatggcgaagaaagccgag
caagcgaagacggtcaaaaggatggttaattggatatggaaccaatttatctcattgtcc
gattgtcaaaatctcatactgatctgtttgggagaaggctgtgctgcgcttcctgtgctc
tttgatatcaaagacttctctgataagttgaaggcctcggtccacatccctagttccagg
cagcctcctcttgtgtttccgaacgactgcaactggcatagggcgatatcagctggattc
ttaggttcgactgaggaagatcgagcgaagatccaaaacacggccaaggagtattcttac
ggaaaagtcagcgtatctgacaagttcaggccgagccagatcttgcgatcagagtgggac
aagatcaccgagttcatccacgccaagttggccggcgatctgccccccaacggaccccaa
actaatggtaatactctcagtcgtcggacctctcagatcgccagcaatggtcgcccaatc
cccaatggtactcctaatggccttcgttctgagcctcctgctctgccgatggatcttgat
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system