KEGG   Puccinia graminis: PGTG_15625Help
Entry
PGTG_15625        CDS       T02226                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pgr  Puccinia graminis
Pathway
pgr00230  Purine metabolism
pgr01100  Metabolic pathways
Module
pgr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PGTG_15625
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PGTG_15625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 ABC_tran RsgA_GTPase AAA_16 MMR_HSR1 ATPase_2 AAA_28 AAA_29 dNK Adeno_IVa2 NACHT AAA_24 RNA_helicase AAA Viral_helicase1 Dynamin_N AAA_21 cobW DLIC PduV-EutP Roc
Motif
Other DBs
NCBI-GeneID: 10545228
NCBI-ProteinID: XP_003334081
UniProt: E3KZD7
AA seq 252 aa AA seqDB search
MYKHCLHQLIQPIHQRLTKPSISSFINTPTKHPIRTTSTSMAPSASAQLQPIVVFGPSGS
GKSTLIKRLQASQDWPQFGFSVSHTTRKPREGEADGVAYHFVSRESFQEMVTKGEFIEHA
EFGGNCYGTSLKAVSEVSEHQKKRCILDIDAQGVKLILKNHPSLSPLIIFVCPPSIEELR
SRLEARGTESEESLKSRLGMAQSEIDYAKSGPSDLIIVNKNLDEAYRKFHLACTVNKNEN
PSQFPQSDPIPF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtataaacactgcctccaccagctcatccagcccatccaccaacgacttaccaagcca
agcatctcctccttcatcaacacacccaccaagcatcccatcaggaccacctccacaagc
atggccccatccgcctccgctcaactacagcctatcgtcgtctttggaccatccggaagt
gggaaatctactctgatcaaaagactgcaagctagtcaggactggcctcagtttggcttc
tccgtctcccataccacacgtaaaccgagagagggtgaagcggatggagtggcttaccat
ttcgtcagtcgggagagcttccaagaaatggtcaccaaaggcgaatttatcgaacatgct
gaattcggtggaaattgttacggaacttccttgaaggcggtttctgaggtatccgaacat
cagaagaagagatgcatcttagatattgatgcccaaggagtgaaattgattctcaagaac
catccgagcctcagcccactcatcatctttgtctgtccgccatcgatcgaggagcttcga
tccagattggaagcccgaggaacggagtcggaggagagcctgaagtcgaggctaggcatg
gcccaaagtgagatcgactatgccaagtctggcccttctgatcttatcatcgttaataaa
aacttggacgaggcgtatcgcaagtttcatttggcttgtacggtcaataaaaacgaaaac
cccagccagtttcctcagtccgatccgatcccattctga

DBGET integrated database retrieval system