KEGG   Puccinia graminis: PGTG_15625Help
Entry
PGTG_15625        CDS       T02226                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pgr  Puccinia graminis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pgr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MYKHCLHQLIQPIHQRLTKPSISSFINTPTKHPIRTTSTSMAPSASAQLQPIVVFGPSGS
GKSTLIKRLQASQDWPQFGFSVSHTTRKPREGEADGVAYHFVSRESFQEMVTKGEFIEHA
EFGGNCYGTSLKAVSEVSEHQKKRCILDIDAQGVKLILKNHPSLSPLIIFVCPPSIEELR
SRLEARGTESEESLKSRLGMAQSEIDYAKSGPSDLIIVNKNLDEAYRKFHLACTVNKNEN
PSQFPQSDPIPF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtataaacactgcctccaccagctcatccagcccatccaccaacgacttaccaagcca
agcatctcctccttcatcaacacacccaccaagcatcccatcaggaccacctccacaagc
atggccccatccgcctccgctcaactacagcctatcgtcgtctttggaccatccggaagt
gggaaatctactctgatcaaaagactgcaagctagtcaggactggcctcagtttggcttc
tccgtctcccataccacacgtaaaccgagagagggtgaagcggatggagtggcttaccat
ttcgtcagtcgggagagcttccaagaaatggtcaccaaaggcgaatttatcgaacatgct
gaattcggtggaaattgttacggaacttccttgaaggcggtttctgaggtatccgaacat
cagaagaagagatgcatcttagatattgatgcccaaggagtgaaattgattctcaagaac
catccgagcctcagcccactcatcatctttgtctgtccgccatcgatcgaggagcttcga
tccagattggaagcccgaggaacggagtcggaggagagcctgaagtcgaggctaggcatg
gcccaaagtgagatcgactatgccaagtctggcccttctgatcttatcatcgttaataaa
aacttggacgaggcgtatcgcaagtttcatttggcttgtacggtcaataaaaacgaaaac
cccagccagtttcctcagtccgatccgatcccattctga

DBGET integrated database retrieval system