KEGG   Puccinia graminis: PGTG_15756Help
Entry
PGTG_15756        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pgr  Puccinia graminis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PGTG_15756
   03420 Nucleotide excision repair
    PGTG_15756
   03430 Mismatch repair
    PGTG_15756
   03440 Homologous recombination
    PGTG_15756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 223 aa AA seqDB search
MSTYASRYTDGDDYGGGGGGGFMQGSQNNNTPGGTRRVEQALRPVTIKQVLDAEASNTDS
AISIQDIDVTNVSFCGVVRDIVRNATNVLLQVEDGTGGIEVRKWIDSSDGESEGFEAETG
IQIRDWVRVIGSPKLFNNKKNVAGLRIEKITDFNEINYRLLDANKIMEYFASIQPPDEGI
NIHEIARQCNLDVKEVIDETAQLIHEGELFTTVDDEHLMTTTS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctacgcctcgcgctacacagatggggacgattacggcggtggtggaggagga
gggttcatgcaaggctcccagaataacaatacacccggtggcacccgccgtgtcgaacaa
gctctacggcccgtgacgatcaaacaagtgctggatgccgaagcctcaaacaccgactca
gcaatttcgatccaagatatcgatgtcactaatgtctcgttctgtggagtggttcgtgat
attgtcaggaacgcaaccaacgtactgttgcaggtcgaagatggaacaggcggaatcgaa
gtccgaaagtggatcgattcgagcgatggggagagcgaaggattcgaggctgagacggga
attcaaattcgagattgggtacgagtgattggatcaccaaaactgtttaataacaagaag
aatgtcgctggactccgtatagagaaaattaccgattttaacgaaatcaactatcgtctt
ctcgatgcaaataagatcatggagtattttgctagcattcaacctcctgatgagggcatt
aacatccacgagattgcgaggcagtgcaatcttgacgtgaaagaggtgattgacgaaacg
gcacagctgatccatgaaggcgagttgtttacaacagtggacgatgaacatctcatgact
acaacctcctaa

DBGET integrated database retrieval system