KEGG   Puccinia graminis: PGTG_15775Help
Entry
PGTG_15775        CDS       T02226                                 

Definition
histone deacetylase HOS2
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 553 aa AA seqDB search
MNLPTFAASASFFDFDPIQSNGPEATTSAAEQQDPPWKMTDPSIRAHSPSRVSYYFPKGV
GDYHFGKGHPMKPHRLTILNHLVAGYGLHHHMEYHSPRLANREELGSFHSSSYLDFLERN
NIRLGEDPKSNNPTSNSGEHNTGEDCPMFDGIYDFCRQYAGASLMASRKLNSGTSDITIN
WSGGLHHAKKSEASGFCYVNDIVIGIIELLRIHPRVLYIDIDIHHGDGVQEAFYLSNRVC
TVSFHKYNGEFFPGTGTIDEFGYGLGKNFSFNLPLSDGIDNESYVNLFRSVMEPIITTFR
PSVIVLQCGADSLGGDRLGGFNISIAAHGECVRFIKAFRIPLMVLGGGGYTPRNVARCWT
YETSLLVSDTCPSISNHLPSTPYDSIFKDEPRLHVNLVTKVDNSNSKKTLEGLRVGILER
LRYMHGAPSVQMQLIPPSLSQWLEEEEEMIEKEREKAVDERPPQSRSTGLLDYFPTNARL
PGAIIPAHDLTPAIKPLPASRTRANYGLTNPGRKRAQTAKSSTQYTAAQEKQKDDAARVQ
ALANQVDDRMQLG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaacctccccactttcgccgcatcagcatcctttttcgatttcgacccaatccaatca
aacgggcctgaagctaccacctcagcagcagaacagcaagatccaccatggaagatgact
gacccatcaatcagggcccattctccgtctagggtatcctactatttccccaagggagtc
ggagattatcatttcgggaaagggcatcccatgaaacctcatcgactcacaatcctaaat
catctcgtcgccggttatgggctacatcatcacatggaatatcactcccctcggctagca
aatcgagaagaattaggatcatttcattcttcctcctatctggatttcttggagcgaaat
aacatacgactgggagaagatcctaaatcaaataatccgacgagcaattcaggcgaacat
aacaccggtgaagactgtccgatgtttgatgggatttacgatttctgtcggcagtatgcc
ggcgcaagcttgatggcctctcggaaactcaactcgggtacatcagatatcacaatcaat
tggtcgggtggacttcatcacgctaagaaatctgaagcttccggtttttgttatgtcaat
gacatcgtaatcggaatcattgagctactaagaatccatcccagagtactctacatcgac
atcgacattcatcatggagacggagtccaagaggcattctatctctcgaatcgagtctgc
acagtctcatttcacaaatataatggcgagtttttccctggcacaggtacgatagacgag
tttggatacggattggggaagaattttagcttcaacctacctctctcggatggaatcgat
aacgaaagttatgtaaaccttttccgatcggtgatggagccgatcatcacaacctttcga
cctagtgtgattgtgcttcaatgtggggcggactcattgggtggagatcggctgggcggc
ttcaacattagcattgccgcacatggtgaatgtgtccggtttattaaggctttccgcata
ccactcatggtattaggtggagggggttacacaccgcgcaatgtggcacgttgttggacg
tacgaaacctccctattggtctctgatacatgtccgagtatatccaatcacctcccctct
acgccctacgactcgattttcaaagacgaaccgcgtctgcacgtcaatctagtcactaag
gttgacaacagcaactccaaaaagacactcgaaggtctccgggtcggaatcctcgaacgc
ttacgatatatgcatggtgcgccaagtgttcagatgcaattgatcccacctagcctatca
caatggctcgaagaagaagaagagatgatagagaaagagagggagaaagcggtggatgaa
cgcccccctcagtctcgctcgactggcctcctcgattacttccccacaaatgcaagactt
ccaggggccattattcctgctcacgacctgactccggctataaaacctttgcctgcctcg
cgtacgagagctaactatggcctcaccaaccccggtcgtaaacgcgctcaaactgccaag
tccagcactcaatacactgcagctcaggaaaaacagaaagacgatgcggctcgtgtgcag
gcattggctaatcaagttgacgatcgcatgcagctcggatga

DBGET integrated database retrieval system