KEGG   Puccinia graminis: PGTG_15848Help
Entry
PGTG_15848        CDS       T02226                                 

Definition
(RefSeq) elongator complex protein 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGTG_15848
Transfer RNA biogenesis [BR:pgr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PGTG_15848
Chromosome and associated proteins [BR:pgr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PGTG_15848
   HAT complexes
    Elongator complex
     PGTG_15848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 10545707
NCBI-ProteinID: XP_003334311
UniProt: E3L9I0
AA seq 538 aa AA seqDB search
MSVLIKTCADIISELIEAHQAGKDVNLNGVRQKVAKRNKCSQLPRLVDIIAAVPPDLKPI
LLPKLRAKPIRTASGIAVVAVMSKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQSYTGYE
PTSMRAIRARYDPYEQSQGRVEQLRQLGHSVDKVEFIVMGGTFMSLPASYRDTFIAQLHN
SLSGYTGTDLDSAVLYSELARTKCIGITIETRPDYCLEPHLTSMLRYGCTRLEIGVQSVY
EDVARDTNRGHTVRATCESFQKAKDAGFKVVSHMMPDLPNVGVERDLEQFKEYFENPAFR
SDGLKIYPLLVIRGTGVYELWRTGRYKNYTPNALVDIVARILALIPPWTRVYRVQRDIPM
PLVSSGVENGNLRELALQRLKDFGAVCRDIRHREVGIHEIHFKVRPDQVELVRRDYVANG
GWETFLSYEDPAKDILIGLLRLRKCSPEGTFRKELLEDGPTSIVRELHVYGTAIPLHSRD
PTKFQHQGFGTLLMEEAERIAREEHGSLKLAVISGVGVRHWYARLGYKLDGPYVSKML
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtactcatcaagacctgcgcggatatcatctcagaactcatcgaggcccaccaa
gcaggaaaagatgtcaatctaaacggggtccgacagaaggtagccaagcgaaacaaatgt
tcgcagttacccagattagtcgatatcatagccgccgtcccgcctgatcttaagccgatc
ctcttgcccaagttacgtgcaaagccgatcaggaccgcatccgggatcgccgtggtagcg
gtaatgagcaagcctcatcgatgtccacatatcgcgatgaccggaaacatctgtgtgtat
tgtcccggtggtccagactcagatttcgaatattctactcaaagttacactggttacgag
ccaactagtatgcgtgctattcgcgctcgttacgatccttatgaacagagtcagggaagg
gtcgaacagttacgccagctgggacactctgtagacaaggttgaatttattgtgatggga
gggacgttcatgtcactaccggcgagttatcgggacacatttatcgcccaactacataat
tctttgtcgggatacacaggcacggatctggactcggcggtgttgtatagcgagctagct
cggacgaagtgtattgggatcacgatcgaaacccggccggattactgtctggagccccat
ctgacgagcatgttgaggtacggctgtacgagactcgaaatcggcgttcagtcggtctat
gaagacgtcgctagagatactaatcgtggtcataccgtccgagccacatgtgaatcattc
caaaaagccaaagatgctgggttcaaggtggtctcacatatgatgcctgatttgcctaac
gtcggcgtcgaaagagacttggaacagtttaaagaatacttcgaaaatcctgcgttcagg
tctgatgggttaaagatctatccactcctagtaatccgaggcacgggtgtctatgagtta
tggcggacgggaagatataagaactatacgccgaatgcattagtggatattgtggcccga
atcctagccttgatcccaccctggacacgagtataccgagtgcaacgcgacatcccgatg
ccattagtatcctcgggggttgagaatgggaatcttcgagagctagcattacagcgactg
aaagatttcggggcggtgtgtcgggacatccgacatcgagaggtggggatccatgagatc
catttcaaggtccggcccgaccaggtcgagctcgtccgcagagactatgttgccaatggg
ggttgggaaactttcctctcttatgaggatcctgctaaggatatcctcatcggtctgctc
agactcaggaaatgctcccctgaaggcacctttcgtaaggagttactcgaagatggtccc
acctctatcgtccgtgaacttcacgtctatggcaccgctatccctttgcacagtcgtgac
cctaccaaatttcaacatcaaggatttggaactctattgatggaagaagctgagaggatt
gcaagagaggaacatggtagtctgaaactagctgtgatttctggtgtgggtgttcggcat
tggtatgcgcgtttgggatacaagctcgacggcccttatgtcagtaaaatgttgtga

DBGET integrated database retrieval system