KEGG   Puccinia graminis: PGTG_16455Help
Entry
PGTG_16455        CDS       T02226                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pgr  Puccinia graminis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGTG_16455
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGTG_16455
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PGTG_16455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MPSNHSEHPHKFLKNPRVAAVIPCPFSGGQPRAGVDHGPSHLIQDGLIKSIESVGYSTAL
DELNLSTVLKQDDPDIGILKNPRLVAETNKSLMNTINSHTEKGEFIVTIGGDHSLAIGTL
SGTLNAFPEACVIWVDAHADINTPDTTETGNLHGCPVSFLLSTLHAGKDLEPFEWIQPCL
KPDRLVYIGLRDIDMGERKILKEHNIRCFTMHDVDKHGIGKVVEMALESVNKDLTRPIHL
SFDVDALDPSVAPSTGTPVRGGLTFREGHYICEAIYETGCLVALDLMEVNPTLMTTEADV
IQTLSVGQSLIRSAMGESLI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaaaccattctgagcatcctcacaagttccttaaaaacccacgcgtggcagct
gtcatcccttgccccttcagtggtggacagccacgagctggggtagaccatggaccgagc
catctgatccaagatgggctgatcaaaagcatcgaatccgtgggatactcaaccgccctc
gacgaacttaatctgtcaacggttctgaaacaagacgacccggatattgggatcctcaaa
aaccctcggctggtcgcagagacaaacaaaagtttgatgaataccattaactctcacacc
gagaagggcgaatttatcgttaccatcggtggggaccattctttggctattggtactctg
agcggaactttaaacgccttcccggaggcctgcgtgatatgggttgatgcgcatgcagat
ataaacacacccgatacgaccgagacagggaatctacacggatgcccggtttcgttttta
ttgtcgacattgcatgcgggaaaagatcttgagccattcgaatggatccaaccgtgcttg
aaaccagatcgattggtttatatcggcctgagggatatcgatatgggtgaacgcaaaatc
ttaaaagagcataacattcgctgttttacgatgcacgatgttgataaacatgggatcggg
aaagtcgttgaaatggctttggagagcgtgaacaaagatttaacgcggccgattcatcta
tcgtttgacgttgacgccttggatcccagtgttgccccatcgactgggacgcctgttcgg
ggaggcttaaccttccgcgaaggacattacatctgtgaagcgatctacgaaaccggatgt
ctggtcgcgttggacctcatggaagtcaatccgactctaatgaccaccgaagctgatgtg
attcaaaccctaagcgtaggccaaagcttgatccgatctgctatgggcgaatcattgatc
taa

DBGET integrated database retrieval system