KEGG   Puccinia graminis: PGTG_16535Help
Entry
PGTG_16535        CDS       T02226                                 

Definition
translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
pgr  Puccinia graminis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGTG_16535
Messenger RNA biogenesis [BR:pgr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PGTG_16535
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PGTG_16535
Translation factors [BR:pgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PGTG_16535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MAESATSPTFPSSQLPPVAALASSQAVRSALADYTQASSIPSSSVSSPQLDHSSSSEKED
QEEKDDQSSLEDGEIPTEPAGTSSSASNNPITIFSSQTEFNVKHPLYSTWTLWFDNATKN
DKAKNWDDLIQQVMQVESVEEFWGLYHNIVPPSLIHVGSNYYLFKEGIKPAWEDPANAKG
GSWSIQLSRDRSRDMIDKWWLYTMLAAIGETFETPYTANGKPPATMSFTDEVTGVVISAR
KMFFRISIWTRSADSKELAQNIGRHFKYGVLSIPETFRFAPSDGKSIQTDCEFRSHTDSQ
LKKKKPTFTV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgctaccagtcccaccttcccttcatctcaactaccgcccgtagccgcc
ctagcctcatcgcaagccgtccgaagtgcactagccgactatacccaagcctcctcgatc
ccatcctcatcagtctcatcaccacaactcgatcacagctcatcatccgagaaggaggat
caagaggagaaggacgaccaatcatccttagaggatggcgaaatccctaccgaaccagct
ggcacttcctcctccgcctctaacaatccgatcaccatcttcagctcccaaaccgaattc
aacgtcaaacatccgctctactctacctggaccctctggttcgataacgctactaagaac
gataaggctaagaattgggacgaccttatccaacaggtcatgcaggtcgagagcgtcgaa
gaattttggggactatatcacaacatcgttccaccttcattaattcacgtcggatcgaac
tattacttattcaaagaaggaatcaagcccgcatgggaagatccggccaatgccaagggt
gggagctggagcattcaactgtcgcgcgatcggagtcgtgacatgatcgacaaatggtgg
ctgtacaccatgttagcggcgattggagagacgtttgagaccccatacacagcgaacggg
aagccgccggcgacgatgtccttcaccgacgaagtcacgggcgtcgtcatctcggcccgc
aagatgttcttccggatctcgatctggacgcgctcggccgactcgaaagaactggcccag
aacatcggccgtcacttcaaatacggcgtcctctcgatccccgaaaccttcagattcgct
ccctccgatggcaaatcgattcagaccgattgcgaattcagaagccatactgattcccaa
ctcaagaaaaagaaacctactttcactgtttaa

DBGET integrated database retrieval system