KEGG   Puccinia graminis: PGTG_16563Help
Entry
PGTG_16563        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
pgr  Puccinia graminis
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pgr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 765 aa AA seqDB search
MWRPGKWVYIDDDPNESNSPENNNNRDNSNEPVDPPSPPWKLGQVPVETAIFKDGRRMSR
RFNHINNSTTPPPPQSVPKKARRKSTSHVNSNNHSTTKQSSDTSKNPKYRRKSHAPTKAS
TDTIKNDDSAQPDDHQPQASDPTPQALIHREPLNQEPNQSSTAPVSPNTTSPQNPSSDQE
PGLTLQAHLPDLKDPSKSRSSLTTTEDLPQSIPDFNSVTEAHSAGPPTPPAIEFSSASVS
DRRASAPPSADLLLPPPMKKFKPWEALKSFQTDGSDVVPPRSEARSEAPKAGGSTSTTEE
GKSRSEKSKGKKREGTGSGAESAGLKRGRDVFSSSDLTELSSSLTDLSEEEFSEQQRSSA
SSVIYSEVEIEDDCLPDVLVRKVRRPSRPGPSSSPQKSMAEFIKWQKRKAAVRQLRERKA
ALKSMNPGPNGDPNLDAENWEPPAYIKIKSNVYPFRKPEISDFPPAICNCTDGGCGEKCL
NRAMFYLCDPKLCQLGQACKNLPFNQRKDAIDESSPRLGKGLKVFYTGPIKGWGLKTEIK
LKKDRFLIDYRGEIISRDACYKRVLNEYSGCKHFYLMDYDGSDVIDAGLKGNCARFINHS
CTPNLRVERFKLSGLEEYQFGIFTLRDIEIGEELSYDYGWRNFSDIAPTSNIRTSIRSTQ
DDLDGSSPERKEGEGDARRSTLRRTTTIQSPLVSATAPTVQRCYCGTKGCKGFLGAKKLP
NLSTSTLASSSNAAATSTVPAPAPKVPPVASSSSSTSLKRKKKSS
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgtggagacctggcaagtgggtatacatcgatgacgacccaaacgaatctaactcaccc
gaaaacaataacaaccgcgacaactcgaacgagccagtcgacccaccatcaccgccctgg
aaactaggccaggtaccagtagagacggcgatcttcaaggatggaagaaggatgagtaga
agattcaatcacatcaacaatagtacgactccaccaccaccccaatccgtacccaagaaa
gctcgtcgaaagagtactagtcacgtcaacagcaacaaccatagcaccaccaagcaatcc
tcagacactagcaagaacccaaaatatcgacgaaaatctcacgcccccacaaaggcatca
acagacaccatcaagaatgatgattcagctcaaccggatgatcaccaacctcaagcatct
gatccaacccctcaagctctaattcaccgtgaacctctgaatcaagagcccaaccagagc
tccaccgcaccagtctctccaaacaccaccagcccacagaacccgtcatctgatcaagaa
ccaggcctgacactccaggctcaccttcctgatctcaaagatccatcaaaatcaagaagc
agtctcacaacaaccgaagaccttcctcaatccatccccgatttcaactcggtcaccgaa
gctcactctgctgggccacctactccacccgcaatcgaattctcaagcgcttcagtctcc
gatcgccgcgcctctgccccaccctctgccgatctactactcccaccccccatgaaaaaa
ttcaaaccatgggaagcactcaaaagcttccaaaccgatgggtccgatgtcgtcccgcca
agatcggaagcgcgctcagaagcaccgaaagcgggtggctcaacctccacaacggaagaa
ggcaaaagcaggagcgagaaaagcaaagggaagaagcgtgaaggaaccggttctggggcc
gaaagtgcgggcctcaaacgaggccgcgatgttttctcgtcctcggaccttaccgagctc
tcctcttcgctaaccgatctttccgaggaagagttctcagaacagcaacgttcgagtgct
tcgtcggtgatctactctgaggttgaaatcgaggacgactgtttaccggacgtcctagtg
cgcaaggtccgtcgaccctctcggcccggcccgtcgagctccccccaaaagtccatggcc
gaattcatcaagtggcagaaacgtaaagccgccgtccgtcagcttcgtgagcgaaaggcc
gccctcaaatctatgaatcccggccctaacggcgaccctaatcttgatgctgaaaattgg
gaaccacctgcctacatcaagatcaaatctaacgtctatccctttcgcaaaccggagatc
agcgattttcctccggctatttgtaactgtactgatggtggatgtggggaaaaatgtttg
aacagagcgatgttctatctgtgtgatccgaaactttgtcaactcggccaagcgtgcaag
aacttgccattcaaccaacgcaaagatgcgatcgacgagtcgtcgcccaggctcggcaag
ggcctcaaagtcttttacaccgggccgatcaagggatggggccttaagaccgaaatcaag
ctcaagaaagaccggttcctcatcgactatcgcggcgaaatcatctccagagacgcctgt
tataaacgcgtactcaatgagtacagcggatgtaaacatttttacttgatggattatgat
ggctcggatgtgatcgatgcaggtctgaaaggaaattgcgcacggttcatcaaccattct
tgtacgcctaacttgcgcgtagagaggttcaagttgtcgggcttggaggagtaccagttc
gggatattcaccttacgagacatcgagatcggtgaagagttatcgtacgactacggctgg
agaaacttcagtgacattgcacccacctccaacatccgcacctccatccgttccactcaa
gatgacctggacggatcctctccggagaggaaagaaggagagggagacgctcgtcggtcc
accctccgtcgaaccacgaccatccagagtcccctcgtctccgccaccgctcctaccgtc
caacgttgctactgtggaactaaagggtgcaaaggattcttgggcgctaagaaacttcct
aacctctccacctctactctcgcttcttcttccaatgctgctgccacttctacagtaccg
gcgccggcgcctaaagtccctcccgtcgcgtcttcttcttcttctacctctctcaaaaga
aagaaaaaatcttcttaa

DBGET integrated database retrieval system