KEGG   Puccinia graminis: PGTG_16578Help
Entry
PGTG_16578        CDS       T02226                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PGTG_16578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 427 aa AA seqDB search
MTSASAQRIYKPASAPPAENCPLDSNPQQQQLTKNTKHRMASARSINLLRSSAKQFLPIQ
RLPRATHGLRSSFYYSTAPAGANPSSSSSQAPPPPQGEPKSSKTPLIAGLALGGVGLAYY
FYALDSDSDLQKRYTTPKAANSNLNFQAVYNDIAAILEDSSYDDGSYAPVLVRLAWHASG
TYDKESKTGGSNGATMRFAPESNHGANAGLGVAREKLEPIYKKYARSGLTYSDLWTLAGV
AAIQEIGGPKIPWRPGRQDGVGPDNCPPDGRLPDGDKDQDHVRKIFYRMGFNDQEIVALL
GAHALGRCHTDRSGFEGPWTFSPTTFSNDYYRLLFDEKWQPRKWSGPPQYEDKKTKSLMM
LTTDMCIVMDKSFRNWAKKYATDEKVFFDDFSKAFSKLIELGVPEENFSGKAPMTLKTLD
EQGIQVD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagccagcgcccagaggatatataagccagccagcgcccccccagcagagaac
tgcccactcgatagcaatccacaacaacaacaactcaccaaaaacacgaaacacagaatg
gcttcagctcgatcgatcaacctcttgcgatcctcagcaaagcaatttctgcccatacaa
cgactcccccgggctactcatgggctccgatcatccttctactactccaccgccccggcc
ggagcgaacccctcatcatcatcctcacaagcaccaccccctccgcaaggggaaccgaag
tcgtccaagaccccgttgattgccggcctcgcgctcggtggagtcggactggcctattac
ttctacgccctcgactcggactcggatctccagaagagatacaccacccccaaggccgct
aacagtaaccttaacttccaggccgtctataacgatatcgccgccatcctcgaggatagt
agctacgacgacggatcctatgcgcccgtcctcgtccgtctcgcttggcatgcctccggc
acttacgataaagagtccaagacgggcggcagtaacggagccacgatgcgatttgcgcct
gaaagtaaccatggagccaatgcaggtctgggggtagcccgagagaagctcgagccgatc
tacaagaagtatgcgcgctcggggctgacgtattcggatctctggacacttgcgggggtg
gcggcgatccaggagatcggcgggcccaagatcccgtggcgtccgggacgacaggacggg
gttgggcccgacaactgtccgccggatggacgattgcccgatggtgataaggaccaggac
catgtgcgaaagatcttctaccgcatggggttcaatgaccaggaaatcgtcgccctcctc
ggcgcccatgccctcggcagatgtcacacagaccgctccggcttcgaaggcccctggaca
ttctcccccaccacgttctccaacgactactatcgactgctctttgacgagaaatggcag
cctcgtaaatggtccgggccgccccaatacgaggacaagaagactaagagtctcatgatg
ttgaccacggacatgtgcatcgtcatggacaagagcttccgcaattgggccaaaaaatat
gctaccgatgagaaagtcttcttcgacgacttctccaaagcgttctctaaactgatcgag
ctcggagttcctgaagaaaacttctctggcaaagcgccgatgacgttgaagactttggat
gaacaaggcatccaagtcgattga

DBGET integrated database retrieval system