KEGG   Puccinia graminis: PGTG_16812Help
Entry
PGTG_16812        CDS       T02226                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
Organism
pgr  Puccinia graminis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MVGPSTVPRRHAFPVLNDQFFVDEDYEFVKELGQGAYGIVCSAKNTKTGKSVAIKKVTKI
FTKKILTKRALRELKLLHHFRGHKNITCLYDMDIVNFDSFNEVYLYEELMEADLHAIIRS
GQPLTDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKICDFGLARGFETD
PALAQATNQGFMTEYVATRWYRAPEIMLSFQNYTTAIDMWSVGCILAELLGGRPIFKGRD
YVDQLNQILNYLGTPSETTLRRVGSPRAQDYIRSLPYKQGVSFAELYPGANPEGLDLLSK
LLAFDPSERITCNQALRHPYLKVWHDPEDEIDIKEKFDFSFESEDSTEGMKQLIINEVVS
FRQSVRPNHSLQPAHSSGVAANATATPSDSAPAPSSVNAPVGQTGAAESSPASQSKSSGS
DGHKALPIPSREVVMSSPTNSVVGGTSGATTSTTTTVASSVTMNAQDDGPLIHSPVDDHP
AQDLDAELVARDF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcccatcgactgttcccaggagacatgctttccccgtcttgaacgaccaattc
ttcgtcgacgaagattatgaattcgtcaaagaattgggccaaggtgcttacggtattgtc
tgctcggcaaagaatacaaaaactgggaaaagtgtggcaatcaaaaaagtgactaagatt
ttcactaaaaagatcttgactaaacgggctttaagagaactcaagttattacatcatttc
cgaggccacaagaatatcacgtgtctgtacgacatggatatcgtcaactttgattcgttc
aacgaagtctatctatatgaagaattgatggaagccgatttacatgcaattattcgatcg
ggccaaccattgacagatgcccatttccaatcgttcatctaccaaacgctatgtggccta
aaatatatccattcggcctcagttctacatcgagatttaaagccaggaaacctactagtg
aatgcggattgtgaattgaagatctgtgatttcggcttagcccgaggcttcgagaccgac
ccggctttggcacaagccaccaaccaaggattcatgaccgaatatgtggccacgcgatgg
tatcgagctcctgaaatcatgctcagtttccaaaactatactactgccatcgatatgtgg
tctgttggttgtatcttggcagaattgttgggcggaagaccgatcttcaaggggagagat
tatgtggatcaactgaaccagattctcaactatctgggtaccccgtcagaaacgaccctt
cgaagggtaggatcaccccgagcccaagattatatccgatcattaccctataaacaggga
gtatcatttgcagagctctatccgggggcgaaccccgaaggcctagacctcttaagcaag
ctgttagccttcgacccatcggagcggatcacctgtaaccaagcgctccgtcatccgtat
ctgaaagtctggcatgatccggaggacgagatcgatatcaaggagaagttcgacttcagc
ttcgagtccgaggattcgaccgaaggcatgaaacagttgatcatcaatgaggtcgtcagt
ttccgccaatccgtcagacctaaccattctcttcaacctgctcattcctccggagttgcc
gcaaatgctacggccaccccctccgactccgctcctgctccttcgtcggtcaatgctcct
gttggccagactggagctgctgaatctagtcctgctagtcaatccaaatcctccggatca
gacggccataaagcattaccgattccgtcgcgagaagtcgtgatgagttcgccgacaaac
agtgtcgtaggtgggaccagtggagcgaccacctcgacgacgacgaccgtagctagcagt
gtgacgatgaatgcccaagacgacgggccgctcattcatagccccgtcgacgaccatccg
gcccaggacttggacgccgaactcgtcgcgcgtgacttctga

DBGET integrated database retrieval system