KEGG   Puccinia graminis: PGTG_16962Help
Entry
PGTG_16962        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGTG_16962
Peptidases [BR:pgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGTG_16962
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGTG_16962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 680 aa AA seqDB search
MAQSALPPLAELLKQVNLPTPRSVVYREECTQCFDSQDNPSGIDVCLTCFNGGCVHFKHA
SNHAKKTGHLLAMNIQRTRKPDSHQRSPSAEPPLKKLAITEQTEDQFDIKTSLIYYPSVD
ERKQFSFSEVAEPKIEQAAAAILSASSSTQASEVKAWEEEIETCRHVVDLNQDPNPAPVA
QASATCHACELSSNLWFCLQCGSLGCGRAQYGGTGGNGHALQHYEQTGHCVNVKMGTITA
EGTADLYCYSCDDARTDDRLQEHLAHFAIEIAKQEKTEKSMTELQVEHNMKFDFAMSGEE
GRELHPIEGPGFTGLKNLGNSCYIASVLQVLFALPPFQKRYYQGIFELHSSTCEAANPAD
CFDCQMNKVAHGMLSGRYAVSRCENRARDGSSDTAPTVKSFQEGIKPMMFKAFVGKGHPE
FSTMRQQDADEFMRYLFQFIQRQARQSSARASLLSTMTENDLDPTLPFRFELEEKLQCTT
CQCVRYRYEEQEALSLPVPAVPVTPPTEPELVGITPPGQTTYQPVSLEDCLQSFTTPQSV
EYNCPRCKSKTTALTTSRIASFPKYLAIHTRRFAIVNWVPKKLEIPVIIQGHQVDLENYF
GSGIQPGEEKLPEVEEPTPQKVVNPETLSALESMGFPTAKCRKAIIETGDSGVESATSWL
FEHMDDVEVEEAPSVAQVIA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtctgcccttcctccgttggccgaactgctcaagcaggtcaatttgcctacc
cctcgctcggttgtttaccgtgaggaatgtacacaatgttttgattcgcaagataatcca
tcgggaatcgatgtctgtctgacttgctttaacggtggttgcgtacatttcaaacatgcc
tccaatcacgccaagaagaccggacatttgcttgctatgaacatacaacgtacccgtaaa
cctgactcacatcaacgtagcccttccgctgaacccccactcaagaaattggcaatcact
gagcagactgaagaccaattcgatatcaagacttcgctgatctactatccctctgtcgat
gagagaaaacaattttcattctcagaagttgcggaaccgaaaatcgagcaagccgctgcc
gctatcctttcggcgtcgtcctcgacacaagctagcgaagtcaaagcttgggaagaagaa
atcgagacctgtcgccacgtggttgacttgaaccaagaccccaacccagccccggttgct
caagcttcagctacctgtcatgcatgcgaattatcatccaacctttggttctgtctccaa
tgtggctcgctgggttgcggtcgagctcagtacggcggaacgggcggaaacggccacgcc
cttcaacattacgagcagacgggacattgcgtcaatgtcaagatgggcacgattactgct
gaaggcactgcagatctttattgttacagctgtgatgatgcgcgaaccgatgatcgttta
caggaacatctcgctcatttcgcaatcgagatagctaaacaagaaaaaacggaaaaaagt
atgactgaacttcaagttgaacataacatgaaattcgacttcgccatgtcgggcgaagaa
gggcgtgaattacatcccatcgaaggccctggatttacgggtctcaagaatttaggcaac
agttgctacatcgcatccgttctgcaagtcctatttgcattaccgccgttccagaaaaga
tactaccaagggatatttgagctacatagctcaacctgcgaggcggcgaatccagcagat
tgctttgattgccaaatgaataaagttgcccacggaatgctctcgggtcggtatgctgtt
tcaagatgtgaaaaccgggctagagacggctcgagcgatacggctccaaccgtcaaatcg
tttcaagagggaattaagccaatgatgttcaaagcatttgttggcaagggtcacccggaa
ttctccacgatgcgacaacaagatgccgatgaattcatgcgatacctgtttcaattcatc
cagcgtcaggcccgtcaaagttcggctagagcctcgctcctctccactatgaccgaaaac
gatctggatccaacgttaccttttaggttcgaacttgaagagaaattacagtgtacaact
tgtcaatgtgttaggtatcgctatgaagagcaggaggctctcagtcttcccgttccagct
gttcctgtcactccacccacagagcccgagctggtaggcatcactccgcccggtcaaacc
acttaccagccagtatctctcgaagactgtctccaaagcttcaccacccctcagtcggtc
gagtataactgccctcgctgtaaatctaaaacgactgcgttgacgacttcgcgtattgct
tctttcccaaaatatttggccatccatacgcgcaggtttgcaatagtcaattgggttcct
aaaaaacttgagattcctgtcataattcaaggacatcaagtcgatttagaaaactatttc
ggaagcggaattcaaccgggtgaagaaaagttaccagaggttgaagaacctacaccccaa
aaagttgtgaacccagagactttatccgccttggaaagtatgggatttccgactgccaag
tgtcgtaaggctatcatagaaacgggcgattcgggagtagaaagcgccacgagttggtta
ttcgaacatatggatgatgtcgaagtcgaggaagcgccgtctgtagcacaggtaatcgca
taa

DBGET integrated database retrieval system