KEGG   Puccinia graminis: PGTG_17146Help
Entry
PGTG_17146        CDS       T02226                                 

Definition
(RefSeq) AGC/PKA protein kinase
Organism
pgr  Puccinia graminis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MSTFDPMTVNQADLTFNHPPPPKYAPPASTDLPNLVSPMIQPPTPLGPSTPLSHSTTPSS
ANHQLHPQQQQQQQSHLLQQQQLQQYQQHQHQQHELLKQQQQQLKQQQQQLKQQQHELLL
QQQQQPTNPHFPASSPIPVSTPLESNPSSSQASDPTKTPRKTSSRYALADFDLIRTLGTG
SFGRVHLSKSRHNGRGYAIKVLNKKRVVGLKQVEHTNSERQMLAAVRHPFLVNLWGTFAD
SYNLYMVMDFVSGGELFNLLRKSQRFPDPVAKFFGAEVALALDYLHCLDIVYRDLKPENI
LLGSDGHIKITDFGFAKLVPDITWTLCGTPDYLAPEIVQSKGYNKSVDWYALGVLIFEML
AGYPPFYCEEESPMRLYEKIIAGKVRYPSYFNPSAKDLLKSLLTADLSKRFGNLANGSRD
IFHHGWFAEVDWERLYRKQIPAPYVPRVSSEWDASNFDHYDEASLEEYGKVGEDPYGHLF
PGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctttgaccccatgacagtcaaccaagccgacttgacattcaaccatccacca
ccacccaagtatgcacctcctgcctctactgacttgcccaaccttgtctccccaatgatc
caacctccgactccacttggaccctccactccactgtctcactcaacaacaccatcctcg
gccaaccatcaacttcacccccaacaacaacaacaacaacaatcccacctactccaacaa
caacaactacaacaataccaacaacatcaacaccaacaacacgaactactcaaacaacaa
caacaacaactcaaacaacaacaacaacaactcaaacaacaacaacacgaactactctta
caacaacaacaacaaccaaccaaccctcactttcccgcctcttcacccatacctgtttcc
actcccctagaatccaatcccagtagttctcaagcttccgatccaaccaaaactcctcgc
aagaccagctcgcgttatgcactggccgactttgatctcattcgcaccctcggcactggc
tcattcggtcgagtgcatctctccaaatctcgtcacaacggtagaggttacgcgatcaag
gttttgaataaaaaacgcgtcgtcggtctcaagcaagtcgaacatacaaactcggagcga
cagatgttggctgctgttcgacaccctttcctcgtcaatctctgggggacattcgctgat
tcttacaatctttacatggtcatggacttcgtttctggtggtgaattattcaacctgtta
cgtaagagtcagagatttcccgatccggtggccaaattctttggagccgaagtagccctg
gcactagactacttgcactgtttggatatcgtttatcgagacttgaaaccagagaatatt
ttacttggatcggacggacatatcaagatcaccgattttggattcgccaaacttgtaccg
gatatcacctggaccctttgtgggacacccgattatcttgcccctgaaatagtccagtct
aaggggtacaataagagtgtggattggtatgcacttggggttctgatcttcgaaatgctc
gctggttacccgccgttttattgtgaagaggagagtccgatgaggttgtacgaaaagatc
attgccggcaaagttcggtatccctcatacttcaatccatctgccaaggacctcttgaag
tcgctcctgaccgccgatctatcgaagaggttcggaaacttggccaatggatctcgcgac
atctttcatcatggctggtttgccgaagtggattgggaacgtctctatcgtaaacagatc
ccagcaccttacgttcctcgggttagctcggaatgggacgcttcgaatttcgatcattac
gatgaggcatcacttgaggagtacggcaaagtcggagaggatccttatggtcatctcttc
cccggcttttag

DBGET integrated database retrieval system