KEGG   Puccinia graminis: PGTG_17146Help
Entry
PGTG_17146        CDS       T02226                                 

Definition
AGC/PKA protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pgr  Puccinia graminis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PGTG_17146
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PGTG_17146
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PGTG_17146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MSTFDPMTVNQADLTFNHPPPPKYAPPASTDLPNLVSPMIQPPTPLGPSTPLSHSTTPSS
ANHQLHPQQQQQQQSHLLQQQQLQQYQQHQHQQHELLKQQQQQLKQQQQQLKQQQHELLL
QQQQQPTNPHFPASSPIPVSTPLESNPSSSQASDPTKTPRKTSSRYALADFDLIRTLGTG
SFGRVHLSKSRHNGRGYAIKVLNKKRVVGLKQVEHTNSERQMLAAVRHPFLVNLWGTFAD
SYNLYMVMDFVSGGELFNLLRKSQRFPDPVAKFFGAEVALALDYLHCLDIVYRDLKPENI
LLGSDGHIKITDFGFAKLVPDITWTLCGTPDYLAPEIVQSKGYNKSVDWYALGVLIFEML
AGYPPFYCEEESPMRLYEKIIAGKVRYPSYFNPSAKDLLKSLLTADLSKRFGNLANGSRD
IFHHGWFAEVDWERLYRKQIPAPYVPRVSSEWDASNFDHYDEASLEEYGKVGEDPYGHLF
PGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctttgaccccatgacagtcaaccaagccgacttgacattcaaccatccacca
ccacccaagtatgcacctcctgcctctactgacttgcccaaccttgtctccccaatgatc
caacctccgactccacttggaccctccactccactgtctcactcaacaacaccatcctcg
gccaaccatcaacttcacccccaacaacaacaacaacaacaatcccacctactccaacaa
caacaactacaacaataccaacaacatcaacaccaacaacacgaactactcaaacaacaa
caacaacaactcaaacaacaacaacaacaactcaaacaacaacaacacgaactactctta
caacaacaacaacaaccaaccaaccctcactttcccgcctcttcacccatacctgtttcc
actcccctagaatccaatcccagtagttctcaagcttccgatccaaccaaaactcctcgc
aagaccagctcgcgttatgcactggccgactttgatctcattcgcaccctcggcactggc
tcattcggtcgagtgcatctctccaaatctcgtcacaacggtagaggttacgcgatcaag
gttttgaataaaaaacgcgtcgtcggtctcaagcaagtcgaacatacaaactcggagcga
cagatgttggctgctgttcgacaccctttcctcgtcaatctctgggggacattcgctgat
tcttacaatctttacatggtcatggacttcgtttctggtggtgaattattcaacctgtta
cgtaagagtcagagatttcccgatccggtggccaaattctttggagccgaagtagccctg
gcactagactacttgcactgtttggatatcgtttatcgagacttgaaaccagagaatatt
ttacttggatcggacggacatatcaagatcaccgattttggattcgccaaacttgtaccg
gatatcacctggaccctttgtgggacacccgattatcttgcccctgaaatagtccagtct
aaggggtacaataagagtgtggattggtatgcacttggggttctgatcttcgaaatgctc
gctggttacccgccgttttattgtgaagaggagagtccgatgaggttgtacgaaaagatc
attgccggcaaagttcggtatccctcatacttcaatccatctgccaaggacctcttgaag
tcgctcctgaccgccgatctatcgaagaggttcggaaacttggccaatggatctcgcgac
atctttcatcatggctggtttgccgaagtggattgggaacgtctctatcgtaaacagatc
ccagcaccttacgttcctcgggttagctcggaatgggacgcttcgaatttcgatcattac
gatgaggcatcacttgaggagtacggcaaagtcggagaggatccttatggtcatctcttc
cccggcttttag

DBGET integrated database retrieval system