KEGG   Puccinia graminis: PGTG_17358Help
Entry
PGTG_17358        CDS       T02226                                 

Definition
pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PGTG_17358
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   PGTG_17358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MAGWKLTQALKDKISHFASFPQTGVSLRQMVMFGQNPSAGTLMRASEFLHEELPIRLAHR
VKELNELPNRLNEMPSILKVRDWYAQSFEELVNFPRPELPPEIIAHFEKAFTKGAPLPAL
TPNPSLPPHMQRPLLDTTGKQRLGLSQRYYVDLGDVVWPPEVHDYNERFTQTLSVIKRRH
DPVVTTVAQGILEYKDFLAGPGRSVGTKASASPSVIDRSVQTFLDRFYMSRIGIRVLIGQ
HIALNKLEPHPDYVGVICTNTNVYQICREAIDNALFICEEHYGLFKGPPVQLVCPKDLAF
MYVPSHLNHMVFEVLKNSLRAVVETHGVDADEFPPIKVIVAQGAEDITIKISDEGGGIPR
SAVGLVWTYMYTTAQAQRLDQDFEGTDFKAPMAGFGYGLSIARLYAQYFGGNLKLISMEG
YGTDVYLHLSRLSTTTEPLQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggaagttaacacaagccttgaaggataagatcagccattttgctagcttc
ccccaaactggggtctctttgcgacaaatggtaatgtttggccagaacccgtcggcaggc
acgttaatgagggccagtgagtttctgcatgaggaactgccgatcagactggctcatcgg
gttaaagaactcaacgagctacccaatcgtctcaatgaaatgccgagtatcttgaaagtc
cgggattggtatgcacaatcctttgaggaactagtgaattttcctagaccagaattacct
ccagagataattgctcacttcgaaaaagcctttacaaaaggagctccacttccagcgttg
accccaaatccaagtttacccccacacatgcaacgtcccttacttgataccacaggcaaa
cagcgtctgggcttgagtcaaagatattacgtcgatttgggagatgtggtctggcctccc
gaagtacacgattacaacgaaaggtttactcaaaccctatcagtcatcaaacgacgacac
gacccggttgtcacaacggtagcgcaagggattctcgaatacaaggacttcctagcgggg
ccgggccggagtgtgggcacgaaggcctccgcaagccccagcgtgatcgaccgctccgtc
cagaccttcctcgatcggttctacatgtccaggatcggcattcgggtcctcatcggccag
catatcgccttgaataaactcgaaccccatccagattacgtcggcgtcatttgcacaaat
actaacgtctatcagatctgtcgcgaagctatcgataatgctctgttcatttgtgaggaa
cattatggcctgtttaaaggtccccccgttcaattggtctgtcctaaagacctggccttc
atgtacgttccgagtcatttgaaccacatggtttttgaagttctgaagaattcgttaaga
gcggtagtagaaacgcacggagtcgatgcggatgaattcccgccgatcaaggtgattgtc
gcgcaaggagcggaagacataacgatcaagatatccgatgaggggggcgggatcccacgg
agtgcggtgggtctggtgtggacctacatgtatacgaccgctcaggctcaacgacttgac
caagacttcgaaggaactgattttaaagctcctatggctggctttggttatgggttgtca
atcgctcgactctatgctcaatattttggtggaaacctcaagttgatatccatggaggga
tatgggactgacgtttatttacatctttctcgattgtcaactaccactgaacccttacaa
taa

DBGET integrated database retrieval system