KEGG   Puccinia graminis: PGTG_17649Help
Entry
PGTG_17649        CDS       T02226                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pgr  Puccinia graminis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGTG_17649
   00052 Galactose metabolism
    PGTG_17649
   00500 Starch and sucrose metabolism
    PGTG_17649
   00520 Amino sugar and nucleotide sugar metabolism
    PGTG_17649
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PGTG_17649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 516 aa AA seqDB search
MAAPQVSLNGSSLTAPGPNIQAHAGKRIRGHSQMDFKSATTGVAAKAMRNELSRLAEEVS
DANYRKAFEAEMQGFFLLFSRYLQEKARNTPLQWDRIAPPAADQVVSYSTLPETSDHSIL
DKLAVLKLNGGLGTTMGCVGPKSAIEVRDGMTFLDLSVRQIEHLNSAHKVNVPFILMNSF
NTDDDTARIIQKYANHNIEIMTFNQSRYPRVNRESLLPAPRTATGDKSAWYPPGHGDLYD
AITNSGLLDKLLAAGKEYIFVSNSDNLGAVLDTKIMQHMIDSQAEFIMEVTDKTKADVKG
GTLINYDGNIRLLEIAQVPNDHVEDFKSVRKFKIFNTNNLWVNLRALKRVMESDGMELDI
IVNNKVAENGEAVIQLETAAGAAIQHFRNAHGVNVPRSRFLPVKSCSDLLLVTSDLYQLE
HGRLVMNEARMFQSTPVVKLGDHFKKVAAYQSRFKNIPSMLELDHLTVSGDVKFGRKVTL
RGTVIIVANEGSKIEIPDGTILDNKLLTGNLSIIDH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccctcaagtctctctcaacggttcctcactcaccgcccccggcccaaacata
caggctcatgctggcaaacggatcagaggtcactcccaaatggatttcaaatcagccacg
acaggtgtggccgctaaggcgatgcgcaacgagctctcgagattagctgaggaagtctct
gatgcaaactatcgcaaggcgttcgaggcggagatgcaaggcttcttcttgctcttcagc
cgatatcttcaggagaaagccagaaacaccccacttcaatgggaccgtatcgctcctccc
gccgcagaccaggtggtctcttattccactctgccagaaacctcagatcattcgatctta
gacaagcttgccgtattgaaattgaacggaggtctgggtaccaccatgggctgtgttggt
cctaaatcagccatcgaagtcagggatgggatgacctttttggatctatccgtccgtcag
atcgaacatctcaactcggcccataaagtcaacgtgccgttcatcttgatgaacagtttc
aataccgatgatgacactgcacggatcattcaaaaatatgccaatcataacattgagatc
atgaccttcaaccaatcccgttatccacgagtgaaccgtgaaagtctcttaccagcccca
cgaacggcgacgggcgacaagtctgcctggtacccaccaggacatggagacttgtacgat
gcgatcacgaactctggactgttggacaaactgcttgcagccggaaaagagtatatcttt
gtctccaactcggacaacttgggcgcggtcttggataccaagatcatgcaacacatgatc
gattctcaagccgaattcatcatggaagtcaccgataaaactaaggccgatgtcaagggt
gggacgctcatcaactatgatggtaatatccgactcttggaaatcgctcaggttccaaac
gatcacgtcgaagacttcaagtcggtccgcaagttcaagatcttcaacaccaacaacttg
tgggtgaaccttcgagccttgaagcgagtgatggaatcggacgggatggagttggatatc
atcgtcaataacaaggtggccgagaatggcgaggcggtcatccagctcgaaaccgcagcc
ggtgcggcgatccaacacttcaggaatgcacatggcgtcaacgtccctcgaagccgcttc
ttgcccgtcaagagttgctcggatctcttactggtgaccagtgatttgtaccagctagag
cacggtcgactggtgatgaatgaagccaggatgttccagtcaacccctgtggtcaagctc
ggtgatcacttcaaaaaagtcgccgcctaccaatcccgattcaagaacatcccgagcatg
ttggagctcgatcatttgacggtcagtggggatgtcaagttcgggcgcaaggtgaccttg
agaggcactgtgatcatcgtggctaacgaaggcagcaagattgagatccctgatggcaca
atcttggataacaagttgttgaccggtaacttgtcgatcatcgaccactag

DBGET integrated database retrieval system