KEGG   Puccinia graminis: PGTG_17687Help
Entry
PGTG_17687        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pgr  Puccinia graminis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pgr00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 813 aa AA seqDB search
MTKTSLLAGEVKVLIIDNYDSFTWNLYQYLCLLGASVSVIRSQACSLDELVASYPKLTHL
VISPGPGHPSTDSGISIPAIHHYAGKIPILGICMGLQCIYSAFGGEVTKVGEIVHGKTSL
VSHDGKGLFKALPAHIQCTRYHSLAGRFGTLPSELEVTCWTNSSAELANDPGPFDDQSSI
IMGVRHKLLTIESVQYHPESILSEEGKPFLLNFLNLRGGHWSENPDFQVSPTPKSVPIAS
AESSSKQTILETICLQRAKDLIEAKCIPGLSPTDLKRKLAANVPPVQIDFYERIRRPTTG
KVALMAEIKRASPSKGSFMTPTTPSSPAIAVSYAAAGASVISVLTEPKWFKGTLLDMLEV
RLSVENVPNRPAILRKDFIIDPYQIDEARCYGADTILLIVACLSLDQLRLLYNHAKSLDM
EPLVEVANAAELELALQIKARVIGVNNRNLHDFRVDMNTTSKMLDELNARSSAQNGSSNE
IIMCALSGISSRSDVDRYAAEGVGAVLVGEALMKAEDKVAFVHELLGIPPTPKVTTRKPL
VKICGIKTVEAAVHATNAGADLLGLIFVPKSKRCVTPQQADAIIKAVRKSSESSPKPSLE
TEEIDLDTTDWFSLQSSRLLQKRRTQGKPLIVGVFQNSSLSEIEKVLNQLGDSIDLIQLH
GSEDFRMSKFLSKPVIKAFHIEVERGTTDAGEEVFQEGFRKTLSMINEPGFHSFSILDSS
NLSQCGGTGQSFNWNAVKAVLASSATSSSTTHRNLVIAGGLNAQNVATCIQTFNPFILDI
CSGVEVENCQNGVVENKDFDKISQVIKLIKSDS
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacatcgttactggccggtgaagtcaaagtactgatcattgataattatgac
agtttcacctggaacctgtatcaatacttgtgtctccttggcgcgtctgtttccgtgatc
cgctcgcaagcctgctctctggatgaactcgtagcctcctacccgaagctcacccatcta
gtcatctctcccggtcccggccatccttccaccgactccggtatctcgatcccagctata
catcattatgctggaaagattccaatccttgggatctgtatgggtctccaatgtatttac
tcagccttcggaggtgaagtcaccaaggttggtgagatcgtccacggaaagacttcgctc
gtctctcacgatgggaaaggtctcttcaaagctctccctgcgcacatccagtgtacccga
taccacagtctggccggtcgatttggtaccctgccctccgagttagaagtgacctgctgg
acaaactcaagtgccgagcttgccaatgatcccggtcccttcgacgaccaatcttcgatc
atcatgggcgtcaggcataaactgttgaccatcgaatcagttcaatatcaccccgagagc
attttatcagaagagggcaaaccgttcttattaaacttcctgaacctgcgaggtggacat
tggtccgaaaacccggactttcaagtttctccaactcccaagtccgtccccattgcctcg
gccgaatcatcaagcaagcaaaccattttggaaacgatttgccttcaaagagcaaaggac
ctcattgaggccaagtgcatccctggtttatcccctaccgacctcaaacgcaagcttgcc
gccaacgtccccccagttcaaatcgacttctatgaacgcatccgtcgacccactaccggc
aaagtagctttgatggccgagatcaaacgtgcatctccttcgaagggctctttcatgact
ccaaccactccaagttcgccagcgatcgcagtctcgtatgccgccgctggtgcctcagtc
atctcagtcttaaccgagcccaagtggttcaagggtaccctgttggacatgctggaagtg
agactgtccgtcgagaacgtacccaaccgaccagcgatccttcgcaaagatttcatcatc
gacccttatcaaattgatgaggctagatgttatggggccgatacgatcttgttgatcgtc
gcctgcctcagtcttgatcaattgaggcttctctacaaccatgccaaatctctagatatg
gaacccctggtcgaagtcgctaatgccgccgaacttgaattggccctgcagatcaaggct
cgagtgatcggtgtcaacaatcgcaacttgcacgatttccgggttgacatgaacaccacg
tcgaagatgttggatgagttaaacgcccgaagctctgctcagaacgggagctccaacgag
atcatcatgtgtgctctcagtggaatctcaagtcgatctgatgttgatagatacgccgca
gagggtgttggggcagtgttggttggcgaggcgttgatgaaggccgaagataaggttgcc
tttgtccacgagctgttaggcatcccacccacccccaaagtcaccacccgaaaaccactc
gtcaagatctgtgggatcaagaccgtcgaggccgctgttcatgcgaccaacgccggggcc
gacctcctcggcctgatctttgtcccgaaaagcaaacgctgcgttaccccacagcaagcc
gatgcgatcatcaaagcagtccgaaagtcaagtgagagctcgccgaaaccatcgctcgag
acagaagagatcgacctggacacaaccgattggttcagtttgcaatcatcccgactcctc
cagaaacgcaggactcagggaaaaccattgattgtgggggttttccaaaactcgagcctg
agtgagatcgagaaggttctcaaccaactgggagattcgatcgacttgatccaattgcac
ggatcagaggactttcgaatgtccaaattcctatcgaagccagtcatcaaagccttccac
atcgaggtcgaacgagggacgactgacgcaggagaagaggtttttcaagaaggattccgg
aaaaccttgtcgatgatcaacgagcccggcttccactccttctcgatcttggatagctcc
aacctcagtcaatgtggagggaccggccaatccttcaactggaacgccgtcaaagccgtc
ctcgcttcctccgcaacctcctcctccaccacccatcgcaacttggtcatcgccggcgga
ttgaacgctcagaacgtcgccacttgcatccagaccttcaatcccttcattctcgacatc
tgctcgggagtcgaagttgagaattgtcaaaatggagtggtcgaaaacaaagattttgat
aagatctctcaggtcatcaaactcatcaaatctgattcttag

DBGET integrated database retrieval system