KEGG   Puccinia graminis: PGTG_17688Help
Entry
PGTG_17688        CDS       T02226                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pgr  Puccinia graminis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTG_17688
Enzymes [BR:pgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PGTG_17688
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGTG_17688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 679 aa AA seqDB search
MANNPEKPQLVIDDPWLEPFTQTIEARIQKFKEWQAKIDETEGGLDPFSKGYEKFGLIAQ
ADRSILYREWAPGAQNASLIGDFNNWDREANPMKKDQFGVWECRVPPKGSQPGIAHGSKV
KISMIAQSGERIERLPAWIRRVTQDLSVSPVYDAIYWDPPQKYQWKNKSPPPLDAVKVYE
AHVGISTSEGRVGTYKEFTANVLPRIKALGYNVVQMMAVMEHAYYASFGYQITNFFCASS
RYGTPEELMELVDVAHGMGLTVLLDVVHSHACKNVLDGINMFDGTDHCYFHEGPKGKHEL
WDSRLFNYGHHEVLRFLLSNLRFFMEQFKFDGFRFDGVTSMLYNHHGIGTGFSGGYHEYF
GPGVDEEGVTYLMLANQLVHKINPHAICIAEDVSGMPGLCRPTIEGGLGFDYRLSMAVPD
MWIKLLKEKTDEDWDLGSICFTLTNRRYREKSICYCESHDQALVGDKTLAFWLMDKEMYT
NMSDLTPFTPVIDRGLALHKMIRLITHALGGEGYLNFEGNEFGHPEWLDFPREGNGNSFH
YARRQWNVVDDPLLRYKYLNNFDAAMNNLESQHKWLSSSHTFVSLKHESDRVVAFERGKL
LFIFNFHPTQSYTDYRIGVEWEGKYQVVLSSDEKQRFGGHDRVDLQSEYFTTKMEWNNRK
NYVQVYLPSRMVLVLGLKA
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaatccagagaagcctcagctggtgatcgatgacccttggctagaaccattc
acccagaccatcgaggctcggattcaaaagtttaaggaatggcaggccaagatagacgag
accgaaggaggattagatccgttctcgaaaggatatgagaaattcggattgattgcccaa
gcggatcgatcgatcttatatcgcgaatgggctccaggcgctcaaaatgccagtctgatc
ggcgacttcaataattgggaccgggaggctaacccgatgaaaaaggatcagtttggggtt
tgggaatgtcgggtaccacccaaaggctcccaacccggtattgctcatggaagtaaagtc
aagatctctatgattgctcagagtggggaacgtatcgaaaggcttccggcttggatcaga
cgagtgacccaggacctgtcagtctctccagtttatgatgcaatctattgggatccacca
cagaagtatcagtggaaaaacaagagtccgccgcccttggatgctgtcaaagtctatgaa
gcacatgtgggtatctccacttctgaaggccgggtgggaacatacaaagagttcactgcc
aacgttcttccccggataaaagctttgggatataacgtagtccaaatgatggctgtcatg
gaacacgcttattatgccagctttggttatcagatcaccaatttcttctgtgccagtagt
cgctacggaactccggaggagcttatggaattagtcgatgtcgcccatggaatgggcttg
actgtattactcgatgtcgtccattcacatgcctgcaaaaatgtcttggacggcatcaac
atgtttgacggaaccgatcactgctattttcatgagggtcccaaggggaagcatgagcta
tgggatagccgtttgtttaattacggtcatcatgaggtgctacgattcttactctccaac
cttaggttcttcatggagcagttcaaatttgatgggttcagatttgatggtgtaactagc
atgttatacaatcatcacggaattggaaccgggttctcaggtggatatcatgaatacttc
gggcctggtgttgatgaagagggagttacctatctgatgctggcgaatcagctagttcat
aaaattaatcctcatgcgatctgtattgctgaggatgtttctgggatgcctggactctgt
cgaccgacaatcgaaggggggcttggctttgactatcgcctatcgatggcagtacctgat
atgtggatcaaactactgaaagaaaagactgacgaggattgggatttgggatcgatttgc
ttcacattgaccaaccgaaggtaccgagaaaaatcaatctgctactgtgaaagccacgac
caagccctcgtcggggacaaaactttggccttctggttgatggacaaggaaatgtataca
aacatgagcgatttaaccccattcacaccggtaatcgatcggggcctggctttgcacaag
atgatcagacttataacccatgcccttggcggtgagggatatttgaattttgaaggtaat
gagttcgggcatcctgagtggttagattttcctcgcgaggggaacggaaattctttccat
tacgcacgacggcaatggaacgtggtcgatgatccgttgttacggtataaatatctcaat
aacttcgatgcggccatgaataacttggagtcccagcacaaatggctctccagctcgcat
acctttgtttctctcaagcacgaatctgacagagtggttgcattcgaacgagggaaattg
ttattcatttttaacttccatccgactcaatcctacacagattatcggattggggttgaa
tgggaagggaaataccaggtggtgctctccagcgatgaaaagcaacgctttggaggacac
gatcgtgtggatcttcagtctgaatatttcacaactaagatggaatggaacaaccggaag
aactacgtccaggtttatttgcctagccgaatggtcttggtccttggattaaaggcctga

DBGET integrated database retrieval system