KEGG   Puccinia graminis: PGTG_17927Help
Entry
PGTG_17927        CDS       T02226                                 

Definition
alphaK A6
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     PGTG_17927
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   PGTG_17927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 711 aa AA seqDB search
MPVLNNIILKHPSISHSPQPHPIPQQQPVPNFLSEETLSFAPAPSPPQYPQQALQPSMNI
FRMLSGINKRTQVAPYSKNKPPRSSSKSTSDKDNKRLIDCGFVLYVNNKINTQTGILNVK
QKVDLDNPKLYGDLLDSLWGLFSIQLEKKSLLPHSPDSSEGCVSLAQGKSVLPTPEALEY
VVRKSNDQKPVLINIIYQYKTPQDKSSDSEYSSSNNNSNTSSKPATRSSRPRSTTNTKFS
KSRSKDYDSSDDSNCSLEENLLIAKSSTQSSRKKSLVDDSTRHSRKQSTQTCRKKSVNQS
RSSDDNNTSSDDNITIMPLPTQPLVKNPLQDHHPKNKTSRSTISGVSPVKKIRNSWASAG
IASTMPRLGSSSLSTQLCILGQNNNDIVDVVKTGWIHANQFIFKTFERTEYKLLKADTKP
ITLRIFRDVIIGQGSMRRALKAEVKSISEDGAEIISNYVAKIRYKENVSSLSFHANDAMM
YEASGLLLRKFKSIIAESNRVKQQFKQRAKKMEIVRHAVVATGDTQFPSEVFFLEAALEG
TYVKYSSNIDFDVAEDQPRMEPRICQLMNAFTHWSYVESKGNSLICDLQGVGPILTGPQI
IDLDHTRWADGNNAKEGISMFIKNHICNKFCIQLRLESPDTINKDNPSNISTSNQLQRLT
GRITTPKRPPAHQIQMQSSLPIKSSLSHIINYANGALSSGWLSDHPATTTD
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccggtattaaacaacatcatattgaagcatccctccatcagccactcgcctcaacct
catccaatcccccagcaacaaccagttcccaatttcctttccgaagaaacactgtcattc
gccccagctcccagccctcctcagtacccccaacaagcacttcagccctcgatgaatatt
ttcagaatgctgtcaggaataaacaaaagaactcaagtcgcaccatattccaagaataag
cctccccgatcctcctcaaaatcaacttccgacaaggataacaaacgtttaattgactgt
gggtttgttttatatgtcaataacaagatcaacacccagaccggcattctcaatgtgaag
cagaaagtcgacctcgacaacccaaagctttatggagaccttctcgactctctctggggg
ttgttttctatccagcttgagaaaaaatcattactccctcactcacccgattcatcagaa
ggatgtgtcagccttgcccaagggaaaagtgtattgcccactccagaagccctagaatat
gttgttaggaagtcaaatgaccaaaagcctgtcctgatcaacattatttatcaatacaaa
actcctcaagataaatcctcagattcagaatattcttcttccaacaacaacagcaacacc
tcttccaagccggcaactcgatcctcgcgaccaagatcaaccacaaataccaaatttagc
aagtcacgctctaaggattacgattcttctgatgatagtaactgctctttggaagaaaac
ctcttgattgcaaagtcatccactcaatcttccaggaaaaagtctttggttgatgattca
actcgacattctagaaaacagtcaacccaaacttgccgaaaaaagtctgttaatcagtct
cgttcatctgatgacaacaatacgtcctctgatgacaatatcacaatcatgccactgcca
acccaacctttggtcaaaaaccctcttcaagaccatcatcccaaaaacaaaacctctcga
tctacgatatcaggtgtctcccccgtgaagaaaattcggaactcatgggcttctgcgggt
attgcaagtacaatgccccgattgggaagttccagcctgtccacccagctatgtattctg
ggacagaataataatgatattgttgatgttgtcaaaactggctggatccatgccaatcaa
tttatattcaagacctttgaacgaactgaatacaaactgctgaaggcagataccaaaccc
atcacattaaggatctttagggatgtgatcattggtcagggaagtatgagacgtgcattg
aaggctgaagtgaaatcaatttctgaagatggcgcggaaataatctcaaactatgttgca
aagattcgatataaagaaaatgtgtcatcactctcattccatgcaaatgatgccatgatg
tatgaagctagtggacttctattgagaaagttcaagtcgatcattgctgaaagtaaccga
gtcaaacaacaattcaaacaaagagcaaagaaaatggagattgtacgccacgctgttgtc
gcaaccggagatactcaattcccttccgaagtctttttcttggaagcagccctggagggc
acatatgtcaagtattcaagtaacattgactttgatgttgctgaagatcaacctagaatg
gaaccgagaatctgtcaattaatgaatgcgttcacacactggtcctatgttgaatcaaag
ggtaacagcttgatttgtgacttacaaggagttgggccaatcctcaccggaccacaaatc
attgatttggaccatacgcgatgggctgatggtaataatgcaaaggaaggcatttcgatg
tttatcaaaaaccacatctgtaacaaattttgtatacaactcagattggaatctcctgat
acaatcaataaagataatccctcaaacatttcaacttccaaccaactacaaagacttact
ggaagaattacgactcctaaaagaccacctgctcaccaaatacaaatgcaatcttccctt
ccgataaaatccagtctttctcatatcattaattatgccaatggagctctttcttctggc
tggttatctgatcatcctgcaaccaccaccgactag

DBGET integrated database retrieval system