KEGG   Puccinia graminis: PGTG_18746Help
Entry
PGTG_18746        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgr  Puccinia graminis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTG_18746
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_18746
   00020 Citrate cycle (TCA cycle)
    PGTG_18746
   00620 Pyruvate metabolism
    PGTG_18746
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PGTG_18746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MLGVLSRHALSASLLRRSTASTRQIHSSAQAYALSKFSMPAMSPTMTEGGIASWKKKEGE
SFAVGDVLLEIETDKATMDVEAQDDGKMAKIIMADGSKAVPVGKAIAIFAEEGEEVSSSE
LEKLISESEASAAPTSKEPSEPKSSKPEPAKESSKSSSPPSSSSSPSSKPSTQSAPRSAI
FATPAAKRIALEKGIPLASIKGSGPNGRILESDLTSYSKAGGASTASSASASGAPYEDLP
VSNMRRTIANRLGASKRDVPHYYLTSEIQMDRVNRLRALFNKAAEERAASSKAGGLKAPT
KLSVNDFVIKASALACADVPEVNSSWQEDFVRQNHHVDISVAVATPTGLITPIVTNVGSR
GLGSISAEIKALATKAKNNQLTPPEYQGGTFTVSNLGMFGSVSHFTAIINSPQSCILAVG
GAEKKLAIDEDPAGKGFKEIEVMKVTLSCDHRVVDGAVGARWLKAFKGYMENPLSFML
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgtcctctctcgtcatgccttatcagcttcacttctcaggcggtcaacagcc
tccactcgccaaatccacagctcggcacaggcttatgcactcagcaagttctcaatgccc
gccatgtcccccacgatgactgagggtggaatcgcaagttggaagaagaaagagggagaa
agctttgcggttggggatgtcttacttgagatagaaactgataaagctaccatggatgtg
gaagcccaggacgatggaaaaatggccaagatcattatggccgatggatcaaaagcggtt
ccagtcggaaaagcgattgcaatctttgccgaggaaggggaagaggttagcagtagcgaa
ttagaaaaattgatctcggaaagcgaagcctcggcagcaccaaccagcaaagaaccctcc
gagcccaaatcctccaaaccagaacctgccaaggagagctccaagtcatccagccctcca
tcttcatcaagctccccctcctccaaaccatccacccagtccgctccacggtctgcgatt
ttcgccaccccagccgccaagcgcatcgcacttgaaaaggggattccattggcttcaatc
aagggatccgggcccaacggacgcatcctcgaatccgacctaacctcgtactcgaaagct
ggaggagcttcaaccgcctcttccgcctcggcttccggtgctccctatgaagacctcccg
gtatccaacatgagaaggacgattgccaatcggttgggcgccagcaagcgtgacgtacct
cactactacttgacatccgagattcagatggatcgggtcaaccgtctccgggcgctcttt
aacaaggctgccgaggaacgagctgcttcttcaaaagctggtggactgaaggcacccact
aaattgagtgtcaatgacttcgtcatcaaggcctctgccttggcctgtgcagacgtcccc
gaagtgaactcgagctggcaagaagacttcgttagacaaaaccatcacgtagacatttca
gtggcagttgccacaccaaccggtctgatcacaccaattgtgacgaacgtaggaagtcga
ggtttaggttcgatttcagcggaaatcaaagccttggcaacgaaggcgaagaacaaccag
ttaaccccaccagaataccaaggcgggaccttcaccgtctcgaatttagggatgttcggc
tccgtcagccacttcacggcgatcatcaattcccctcaatcttgcatcttggctgtcggt
ggggccgagaagaagttggcgatcgacgaggatcctgccgggaaaggattcaaagagatc
gaggtcatgaaggtcactttaagctgtgatcatcgtgttgttgatggggctgttggagct
agatggctgaaagcattcaagggttacatggaaaacccactttcattcatgctctaa

DBGET integrated database retrieval system