KEGG   Puccinia graminis: PGTG_18746Help
Entry
PGTG_18746        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgr  Puccinia graminis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pgr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgr00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MLGVLSRHALSASLLRRSTASTRQIHSSAQAYALSKFSMPAMSPTMTEGGIASWKKKEGE
SFAVGDVLLEIETDKATMDVEAQDDGKMAKIIMADGSKAVPVGKAIAIFAEEGEEVSSSE
LEKLISESEASAAPTSKEPSEPKSSKPEPAKESSKSSSPPSSSSSPSSKPSTQSAPRSAI
FATPAAKRIALEKGIPLASIKGSGPNGRILESDLTSYSKAGGASTASSASASGAPYEDLP
VSNMRRTIANRLGASKRDVPHYYLTSEIQMDRVNRLRALFNKAAEERAASSKAGGLKAPT
KLSVNDFVIKASALACADVPEVNSSWQEDFVRQNHHVDISVAVATPTGLITPIVTNVGSR
GLGSISAEIKALATKAKNNQLTPPEYQGGTFTVSNLGMFGSVSHFTAIINSPQSCILAVG
GAEKKLAIDEDPAGKGFKEIEVMKVTLSCDHRVVDGAVGARWLKAFKGYMENPLSFML
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgtcctctctcgtcatgccttatcagcttcacttctcaggcggtcaacagcc
tccactcgccaaatccacagctcggcacaggcttatgcactcagcaagttctcaatgccc
gccatgtcccccacgatgactgagggtggaatcgcaagttggaagaagaaagagggagaa
agctttgcggttggggatgtcttacttgagatagaaactgataaagctaccatggatgtg
gaagcccaggacgatggaaaaatggccaagatcattatggccgatggatcaaaagcggtt
ccagtcggaaaagcgattgcaatctttgccgaggaaggggaagaggttagcagtagcgaa
ttagaaaaattgatctcggaaagcgaagcctcggcagcaccaaccagcaaagaaccctcc
gagcccaaatcctccaaaccagaacctgccaaggagagctccaagtcatccagccctcca
tcttcatcaagctccccctcctccaaaccatccacccagtccgctccacggtctgcgatt
ttcgccaccccagccgccaagcgcatcgcacttgaaaaggggattccattggcttcaatc
aagggatccgggcccaacggacgcatcctcgaatccgacctaacctcgtactcgaaagct
ggaggagcttcaaccgcctcttccgcctcggcttccggtgctccctatgaagacctcccg
gtatccaacatgagaaggacgattgccaatcggttgggcgccagcaagcgtgacgtacct
cactactacttgacatccgagattcagatggatcgggtcaaccgtctccgggcgctcttt
aacaaggctgccgaggaacgagctgcttcttcaaaagctggtggactgaaggcacccact
aaattgagtgtcaatgacttcgtcatcaaggcctctgccttggcctgtgcagacgtcccc
gaagtgaactcgagctggcaagaagacttcgttagacaaaaccatcacgtagacatttca
gtggcagttgccacaccaaccggtctgatcacaccaattgtgacgaacgtaggaagtcga
ggtttaggttcgatttcagcggaaatcaaagccttggcaacgaaggcgaagaacaaccag
ttaaccccaccagaataccaaggcgggaccttcaccgtctcgaatttagggatgttcggc
tccgtcagccacttcacggcgatcatcaattcccctcaatcttgcatcttggctgtcggt
ggggccgagaagaagttggcgatcgacgaggatcctgccgggaaaggattcaaagagatc
gaggtcatgaaggtcactttaagctgtgatcatcgtgttgttgatggggctgttggagct
agatggctgaaagcattcaagggttacatggaaaacccactttcattcatgctctaa

DBGET integrated database retrieval system