KEGG   Puccinia graminis: PGTG_19444Help
Entry
PGTG_19444        CDS       T02226                                 

Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGTG_19444
Transfer RNA biogenesis [BR:pgr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PGTG_19444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MSVLIKTCADIISELIEAHQAGKDVNLNGVRQKVAKRNKCSQLPRLVDIIAAVPPDLKPI
LLPKLRAKPIRTASGIAVVAVMSKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQSYTGYE
PTSMRAIRARYDPYEQSQGRVEQLRQLGHSVDKVEFIVMGGTFMSLPASYRDTFIAQLHN
SLSGYTGTDLDSAVLYSELARTKCIGITIETRPDYCLEPHLTSMLRYGCTRLEIGVQSVY
EDVARDTNRGHTVRATCESFQKAKDAGFKVVSHMMPDLPNVGVERDLEQFKEYFENPAFR
SDGLKIYPLLVIRGTGVYELWRTGRYKNYTPNALVDIVARILALIPPWTRVYRVQRDIPM
PLVSSGVENGNLRELALQRLKDFGAVCRDIRHREVGIHEIHFKVRPDQVELVRRDYVANG
GWETFLSYEDPAKDILIGLLRLRKCSPEGTFRKELLEDGPTSIVRELHVYGTAIPLHSRD
PTKFQHQGFGTLLMEEAERIAREEHGSLKLAVISGVGVRHWYARLGYKLDGPYVSKML
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtactcatcaagacctgcgcggatatcatctcagaactcatcgaggcccaccaa
gcaggaaaagatgtcaatctaaacggggtccgacagaaggtagccaagcgaaacaaatgt
tcgcagttacccagattagtcgacatcatagccgccgtcccgcctgatcttaagccgatc
ctcctgcccaagttacgtgcgaagccgatcaggaccgcatccgggatcgccgtggtagcg
gtaatgagcaagcctcatcgatgtccacatatcgcgatgacaggaaacatctgtgtgtat
tgtccgggtggtccagactcagatttcgaatattctactcaaagttacactggttacgag
ccaactagtatgcgtgctattcgcgctcgttacgatccttatgaacagagtcagggaagg
gtcgaacagttacgccagttgggacactctgtagacaaggttgaatttattgtgatggga
gggacgttcatgtcactaccggcgagttatcgggacacatttatcgcccaactacataat
tctttgtcgggatacacaggcacggatctggactcggcggtgttgtatagcgagctagct
cggacgaagtgtattgggatcacgatcgaaacccggccggattactgtctggagccccat
ctgacgagcatgttgaggtacggctgcacgagactcgaaatcggcgttcagtcggtctat
gaagacgtcgctagagatactaatcgtggtcataccgtccgagccacatgcgaatcattc
caaaaagccaaagatgctgggttcaaggtggtctcacatatgatgcctgatttgcctaac
gtcggcgtcgaaagagacttggaacagtttaaagaatacttcgaaaatcctgcgttcagg
tctgatgggttaaagatctatccactcctagtaatccgaggcacgggtgtctatgagtta
tggcggacgggacgatataagaactatacgccgaatgcattagtggatattgtggcccga
atcctagccttgatcccaccctggacacgagtataccgagtgcaacgcgacatcccgatg
ccattagtatcctcgggggtcgagaatggaaatcttcgagagctagcattacagcgactg
aaagatttcggggcggtgtgtcgggacatccgacatcgagaggtggggatccatgagatc
catttcaaggtccggcccgaccaggtcgagctcgtccgcagagactatgttgccaatggc
ggttgggaaactttcctctcttatgaggatcctgctaaggatatcctcatcggtctgctc
agactcagaaaatgctcccctgaaggcacctttcgtaaggagttactcgaagatggtccc
acctctatcgtccgtgaacttcacgtctatggcaccgctatccctttgcacagtcgtgac
cctaccaaatttcaacatcaagggtttggaactctattgatggaagaagctgagaggatc
gcaagagaagaacatggtagtctgaaactagctgtgatttctggcgtgggtgttcggcat
tggtatgcgcgtttgggatacaagctcgacggcccttatgtcagtaaaatgttgtga

DBGET integrated database retrieval system