KEGG   Puccinia graminis: PGTG_19999Help
Entry
PGTG_19999        CDS       T02226                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pgr  Puccinia graminis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 308 aa AA seqDB search
MPIEVTFDEPSSSSSSSSASSASRTSDEHEDPYHMDPTMTKGRGGSEEEDIEEAISQLNL
TPQPTSSSLPPPRGTGKEVEGSSTRQEGTSQMEEGASGEDPSTGRSVTVRKEGTSNAEAT
TEEERVGRLATAVREILVCLGEDPTREGLLKTPERYARALLWMTKGYREELGTIIGSAIF
QEEHDEMVIVKEIEIFSLCEHHLVPFIGKIAIGYIPNQQVLGLSKLVRIAEFFARRLQLQ
ERLTKQIALTLNQVIKPRGVAVVIESTHMCMTIRGVQKPGSVTVTSSMLGCFRSKDKTRA
EFLNLIKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgaagtcactttcgacgaaccttcctccagttcttcgtcttcgtctgcttca
tcagcttcaagaacttcagacgaacacgaagacccatatcacatggaccctacaatgact
aaaggaagagggggatccgaggaagaagatatagaagaagccatcagtcaattgaacctg
acaccccagcccacttcatcatcattaccaccaccaagagggacagggaaggaagtagaa
ggctcgagtacacggcaggaagggacaagccagatggaggaaggagcgtcgggggaggac
ccatcgacaggacggagtgtgacggtgcgaaaggaaggcacgtcgaatgcggaagcgact
acggaggaagagcgtgtaggacgactggccacagccgtacgagagatcctggtgtgtcta
ggtgaagatccgacccgcgagggtctcttgaagactcctgaacggtatgcacgagcgtta
ctctggatgaccaagggatatcgggaggaactaggaacgatcatcggctcggcgatcttc
caggaagaacacgacgagatggtgattgtgaaagagatcgagatcttcagtctttgcgag
caccatcttgtgccatttatcggcaagattgcgatcggatacatccccaaccaacaggtc
ttggggctctccaaactcgtccggatcgccgagttcttcgcccgccgattgcagctccag
gaacgcctcacaaagcagatcgcactcaccctcaatcaggtcatcaaacccagaggcgtc
gccgtcgtcatcgaatccacccacatgtgtatgaccattagaggcgttcagaaaccgggc
tccgtcaccgtcacttcttctatgctcgggtgctttcgctcgaaagataaaactcgcgct
gagttcttgaatctcatcaaaagatga

DBGET integrated database retrieval system