KEGG   Puccinia graminis: PGTG_20747Help
Entry
PGTG_20747        CDS       T02226                                 

Definition
STE protein kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pgr  Puccinia graminis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pgr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 559 aa AA seqDB search
MNSKPSLVLPNLNPTNNNNQPSSPPPTTTTTTSSSASASSSRPASKRPPLTIASVSSTSR
NRNLSVSSQLSHHRSQHSISSSIGHEQQTHSPSSTTNRSIVGASLYPTTLPSTFDDEDGK
LNDHQQIIHDIQAAMNGISSTTLNSISTPSNNIIRARSGSSASIIKPISVRRPRTAENLI
NNNKSSNSLTVPSSSTPDNQSLLSSSTTTKTAAATTTATTNGTSHHPTENSNQTIINDQG
TQSSELHDQAETEEAAFDEIEFEPSDLEILNSLGEGAGGEVRKVLHRPSGLYMAKKTIPT
SPNPSLHRQILRELAFNREVADGQSPSIVKYYGAFLEENNTQIAILMEYCEGGSLEAIYK
RIKQRKGRIGEKILGKVAESVLGGLSYLHTRRIIHRDIKPSNILVSKEGLIKICDLGVSG
ELIGSMAGTFMGTSAYMAPERIRGETYSITSDVWSLGLTLLELAMNRFPLVNINEDGVAV
PLQPFELLQTVVTFEMPSMNEEEGIVWTKSLQHFIKTCLDKNPNQRPGPKALLEQHPWIA
KSRTWTPDVKTWLIKVWDW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaacccagtctagtcctacccaacctcaacccaacaaacaacaacaaccaa
ccatcatcaccaccaccaacaacaacaacaacaacctcatcatcagcatcagcatcatca
tcacgacctgcctcaaaacgaccaccactcacaatcgcatcagtctcatccacctctcga
aacaggaacctctcagtcagcagtcaactcagccaccatcgatcacagcactccatctca
agctcgatcggacatgaacaacagactcactctccatccagtaccaccaaccgatcgatc
gtcggagccagcctctacccaaccaccctgccatccaccttcgacgacgaggatggcaaa
ctcaacgaccaccaacagatcatccatgacatccaggctgccatgaacggaatcagctca
acaaccctcaactccatcagcactccctcaaataacattatcagggctcgctccggcagc
tcggcctcgatcatcaaaccgatctcagtccgaagaccaaggactgctgaaaacctcatc
aacaacaacaaatcatcaaactcattgaccgtcccatcctcatccactccagataaccaa
tccctactatcctcatcaacaacaacaaaaacagcagcagcaacaacaacagcaacaaca
aatggaaccagtcatcatcctactgaaaattcaaatcagacgattatcaatgatcaagga
acccaatcctctgagcttcacgatcaagccgagaccgaggaagcggcgtttgatgagatc
gaattcgaacccagcgacctcgagatcttgaactcgttgggcgaaggggcgggaggcgaa
gtgaggaaagtgttgcatcgaccatcgggactatacatggccaagaagaccattccaacc
tccccaaatccgtcgcttcatcgacagatcttgagagaactcgcgtttaatagagaagtc
gccgatggccaatcgccgtcaatcgtcaagtattatggcgcgtttttagaagagaacaac
acgcaaatagcgatcttaatggaatactgtgaggggggatccttagaagcgatctacaag
cgaatcaagcaacggaagggccggatcggggagaagatcctgggcaaagtggccgagtcg
gtgcttggcgggctgagctatctgcacacccgacggatcatccatcgggacatcaagccc
tccaacatcttggtctccaaggagggcttgatcaagatctgcgatctgggtgtctccggg
gaactgatcggctcgatggcgggcacctttatgggtacctctgcatacatggctcctgaa
cgaatccggggggagacatactcgatcacctcggacgtctggtcgctaggcctgacctta
ctggaactagccatgaaccgattcccgttggtgaacatcaacgaggacggggtggcggtc
ccgttgcagccgttcgagctcctccagaccgtcgtcacgttcgagatgccttcgatgaac
gaagaggaaggcatcgtctggactaaaagcttgcaacatttcatcaagacttgtcttgat
aaaaatccaaaccagagaccaggacctaaagcgttactagaacaacatccatggatcgct
aagtctagaacctggacccctgatgtgaagacctggttgatcaaagtttgggactggtga

DBGET integrated database retrieval system