KEGG   Puccinia graminis: PGTG_20899Help
Entry
PGTG_20899        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
pgr  Puccinia graminis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTG_20899
Enzymes [BR:pgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PGTG_20899
Glycosyltransferases [BR:pgr01003]
 Polysaccharide
  Storage polysaccharide
   PGTG_20899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MSESQSHINPLLLSTETAGDTYLVNPLTGTSQDGVSPLHETVSTAAPSTTPSASLHSLAP
PPELSYRTRSQLDDAVQKWALEHGYAINKTNITTHNGEDRATGVDKRKPTPLAHAKLHAR
RRLACTPARQSPSHRTQAWVLWEVFFSFKKKFFQNKKKEKEKKRPTRRPGGIPPGRRYNL
AGREDSLQVGEVVQPRRPGDFYCGFPDGVLPNGLNVVKFSAMHEFQNIHAISKQKIHDFV
RGHFYGHYDFDLDNTLYFFTAGRYDYRNKGVDMFIESLARLNHKLKTMKYKITVVAFIIM
PAATHSYTIEALKGQAVTKQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagtcaaagccacatcaacccgctccttctttcaactgaaacagctggggat
acttatctcgttaaccccctcaccggtacatctcaagacggagtcagcccacttcatgaa
actgtgtctacagcagctccgtcaaccactccgtctgccagtcttcattcccttgcgccg
cctcccgagttatcttataggacccggtcacaactagatgacgctgttcaaaagtgggcg
ttggaacatggctatgccatcaataagacaaacattacaactcacaatggggaggatcgg
gcgacgggggttgataaacgcaagccaaccccccttgcgcacgccaaactgcacgccagg
cgcagattggcgtgcacgcctgcacgccaatctccctcccataggacccaggcatgggtc
ctatgggaggtttttttttctttcaaaaaaaaattctttcaaaacaaaaaaaaagaaaaa
gaaaaaaaaaggcctacacgtcgaccaggaggaatccctcctggtcggcggtacaacctc
gccggccgggaggattccctccaggtcggcgaggttgtacagcctcgccgaccaggagat
ttttattgcgggtttccagatggagtgctacccaatggattgaatgtggtcaagttttca
gcaatgcacgaattccaaaacattcatgctatctcgaagcaaaagattcatgatttcgtg
cgcgggcacttctatggccattatgatttcgacttggataatacactttacttctttaca
gccgggcggtacgactaccgtaacaaaggagtggatatgtttatcgaatctcttgctcgt
ctcaatcataaactcaagacgatgaagtacaaaatcacagtcgtagcgtttatcattatg
ccagcagcgactcattcctacacaattgaggctctcaaaggccaagcggttaccaagcaa
ctctga

DBGET integrated database retrieval system