KEGG   Puccinia graminis: PGTG_21541Help
Entry
PGTG_21541        CDS       T02226                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pgr  Puccinia graminis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:pgr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pgr00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MKQSLWSSTLSCSAVHSKLERWLPPQRSTAGFLLPPHRHTLFTSSQHSDRIVKNQSCNPT
NLPMSQVQTPPGVTITCAVEAGHLAILTPDALKFLATLHRYFEPTRRSLLQRRQLEQARL
DAGGLPNFHSETKWIRDNLAWQAASPAPGLQDRRVEITGPVDRKMVINALNSGAATFMAD
FEDSHAPTWLNNLDGQINMRDAVRRQISFKAPNGKDYKLNDRIATLIVRARGWHLDEPHL
LVDGQPISGGIFDFGLYFFHNAKECIKMGFGPYFYLPKMEHYLEARLWNDIFKVSQDYIH
MPRGTIRATCLIETIPAAFQMDEFIFELKEHSSGLNCGRWDYIFSFIKKMRHNPQFVLPD
RSDVTMTVPFMDAYVRLLIKTCHSRGVAAMGGMSAQIPIKDNPKANEAAINKVKADKLRE
VKAGHDGTWVAHPALVKVALDIFNENMVGPNQYHVRRSEVQVTALDLLNTNVPGKITEHG
IRENISAALQYCANWITGVGCVPIANLMEDAATAEIARLQIWQWVRHGSMTDAHKKITAE
WIDQILEEETAQAKKTTAKGLNPAKVDIAQRYLSSQAHAPVPDDFLTSALMTSLDDMAAP
NRPKL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtctctttggtcgagcactctttcatgctctgctgtccactcaaaactcgaa
cgctggcttcctccacaacggtcaacagctggcttcctcctccccccacatagacacaca
ctgttcacaagttcccaacattctgatcgaatcgtaaaaaaccaaagttgcaatccaacc
aacctccccatgtctcaagtccagactccaccaggcgtgaccatcacctgcgcggtcgaa
gctggccatctggccatcttgacgcccgatgccctcaagttcctggccaccttgcatcgc
tactttgagcccacccgtcgttcccttctccaacgtcgtcaactcgaacaggcccgattg
gatgccggtggtctcccaaacttccactcggaaaccaaatggatcagagacaatcttgct
tggcaagctgccagcccagcccctggtttgcaagatcgtcgggttgaaatcaccggaccg
gtggaccgtaagatggtcatcaatgcgctcaactcaggcgctgctaccttcatggcagac
ttcgaagactcgcatgctccaacttggctcaacaatcttgacggtcagatcaacatgaga
gatgccgttcgaagacaaatctcattcaaagcccccaatgggaaggattataaactcaac
gatcgtatcgccactttgatcgtccgagctcggggttggcatctagatgaaccgcatctg
ctggttgacggtcaacccatcagtggtggtatctttgacttcggactttactttttccat
aatgccaaggagtgcatcaagatgggctttggtccttacttttacctccccaaaatggag
cactacctcgaggcgagattatggaatgatattttcaaagtttcccaggactatattcac
atgccacgtgggacgattcgcgccacttgcttgattgaaactattcctgccgcattccaa
atggatgagttcattttcgagctcaaagaacattcgtctggtcttaattgtggacgatgg
gactacattttctccttcatcaaaaaaatgcgccacaatcctcaatttgtactcccggat
cgttctgatgtcacgatgaccgtcccgttcatggacgcctatgttcgtctcctgatcaaa
acttgtcattccagaggcgttgctgccatgggaggaatgagtgcgcagattcccatcaaa
gacaatcctaaagcaaacgaagcggctatcaacaaagtcaaggcggacaaattgagagag
gttaaggctgggcacgatggaacatgggtcgctcatcctgctttggtgaaagtagccctt
gacattttcaatgaaaacatggttggacccaaccaatatcacgtgcgtcgctcagaagtg
caagtgactgccctcgatttactcaacacgaatgtacccggaaaaatcaccgagcacggt
atccgcgagaacatatctgccgccttacaatactgtgccaattggatcactggggttggt
tgtgtgccgattgcgaatctgatggaagacgctgctactgcagaaatagcgcgtcttcaa
atatggcagtgggttcgacatggttctatgaccgatgcccacaaaaaaatcactgccgag
tggatcgatcaaatcttggaggaagaaactgctcaagccaagaagacgaccgccaaggga
ttaaatccagccaaagtcgatatagcacagcgctatttgagttcgcaagcgcatgcacca
gttcctgatgattttctgactagtgcgctcatgaccagtttggatgatatggctgcccca
aaccgaccaaaactgtaa

DBGET integrated database retrieval system