KEGG   Puccinia graminis: PGTG_21821Help
Entry
PGTG_21821        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PGTG_21821
Peptidases [BR:pgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGTG_21821
Transcription machinery [BR:pgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PGTG_21821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 562 aa AA seqDB search
MASPRIDVKPNLHSPPPSQPKTTPPSSGSATPSVNNHHKRLGCVHQPSRLWNDENDQVIK
NLLGILKALEAAPPASSNQPLLAAFCLRCRTATSPRLVCLGCAAVLCFDNLDRPALKPCY
LSGHSTKSSKCLLGLDLSCRELICMVCGTIVQPDDHELKILSRRLFPQVKRAYAPGCVGR
TTSTIMAPRGFRNLGNSCYMNVILQILLRIPELQGYLLTDHHNRLKHRSADEVWCCACEL
IDILQLHHLQLSQLQQNRSKALAPAEPISPVGFLYALWLNSGDGEEFAGYRESDAHECLL
ACLNQLHTATQVPTPQAGAHAVGPASGSTTTPTTIAAAATTTIASGPPSSAGEPTTRCQC
PIDLLFRCELTSQVVCGSCRKTSYKVDPILDLSLEIGHLNHLETLRLEDCLHSFTKAERL
KEKCYTCHQCSVASPETTKSLTISRLPHILCIQLKRFEHHLSSASKLDRFVKFPLVLDMK
PFASPNLAENRPDLLSSDVDGYYYKLTGIVRHQGNVSSGHYQAIIYQDEQYFCFNDESVS
ILRLEEVLKVEAYILVYTFILP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggctagtccaaggatcgatgtgaagcccaacctccactcgcccccaccgagccaaccg
aagacgacgccgccgtcgagcggctcagctaccccgagcgttaacaatcaccacaagaga
ctaggatgtgtgcaccaaccgagccggttatggaacgacgagaacgaccaagtgatcaag
aacctgctcgggatcctcaaggccctcgaagccgcaccccccgcttcctccaatcagccc
cttctggctgccttctgtctccgttgtcggacggctacttcccccagactcgtctgtctc
ggctgcgctgctgtcctctgcttcgataacctcgatcggcccgccctcaaaccttgttat
ctttcaggccattctactaaatcctctaaatgtctcctcggcttggacttgagttgtaga
gaactgatctgcatggtctgtgggacgatcgtccagccggacgaccatgagctcaagatc
ctaagccgccgactattcccacaggtgaagcgagcgtatgcgccgggctgtgttggacgg
acgacgagcacgattatggcgccccgaggcttccggaacctgggcaacagctgctacatg
aacgtgatcctccagatcctcctgcggatccccgagctccagggatacctgctcacggac
caccataaccggctcaaacatcgctccgctgacgaggtctggtgttgcgcctgcgagctc
atcgacatcctccagctccatcatctccagctgtcccaactccagcagaatcgctccaag
gctctcgcccccgctgagcccatcagtcccgtcggcttcctctatgccctctggctcaac
tccggcgacggcgaagagtttgctggctatcgcgaatcggacgcccatgaatgcttgctc
gcctgtttgaaccaactacacacggcgacccaagtgccgacgccgcaggccggagcccat
gccgtcggcccggcgtccggatcgacaacaacaccaaccacgattgccgccgccgccacc
accacgatagcttccgggccgccgagcagcgctggcgaacctaccactcgctgtcaatgc
ccgatcgatctcttgttcagatgcgaattgaccagccaagtcgtctgcggtagttgtcga
aagaccagctacaaggtcgaccctatcctcgacctttcgctcgagatcggccatctcaat
catctcgaaaccctccggctcgaggattgtcttcacagttttacgaaagcagagcgactg
aaagagaagtgttacacctgccatcaatgttcggtggcgtcgcctgagacgacgaagtcg
ctgacgatctcccggctgcctcacatcctttgcatccaactcaaaagattcgaacaccat
ctttcatccgcttcgaagctcgatcggttcgtaaagttcccgttagtgttggacatgaag
ccgttcgcgtctccaaaccttgccgagaatcgtcccgatcttctttcttcggatgtcgac
ggatattattataaattaactggaatcgtgagacatcaaggaaacgtgtcatcgggacat
taccaagcgataatataccaagacgagcagtatttctgttttaatgatgaatcagtgtcg
attttgagactcgaagaagtcctgaaagtcgaggcgtatatcttagtctacaccttcatc
ctcccctga

DBGET integrated database retrieval system