KEGG   Puccinia graminis: PGTG_22636Help
Entry
PGTG_22636        CDS       T02226                                 

Definition
STE/STE7 protein kinase
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pgr  Puccinia graminis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PGTG_22636
Enzymes [BR:pgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PGTG_22636
Protein kinases [BR:pgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PGTG_22636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 597 aa AA seqDB search
MAQPNKPSSQSISLDSLSLPLLSITSPSQSPTTTTQPTNQLNSNKTPAPSSSSSSSSSSS
SASSAAAATATTTAPDGTTPTPPASIPATITATNNSDYSPSSSPSSSSAASSSSITTNTT
THSNSNSISPTLTKHPTGLPHSAQHPHPPSKPAHRPHVGNPGGVKVPPGLVAKMAAMTKR
KDNLPSSSMPHNQRLDPMAFIGDRPSANSAVSRPAPSPSAMLTPSMSTRRAKPMMKLGDM
HSQPPSSLSSSSSSSSMNNQTKFLSVSGAAAATPFANFSKIVDPSGRLNFGGKAILHSHG
VDFSNGSSFSINMNELTLMEELGKGNYGTVQKVFHKPTKVVMAMKEIRLELDDSKLKAIL
TELDILHRATSDTIVEFYGAFFIESCVYYCMEYMDGGSLDKLAGADVPEPVLARVTGRVV
EGLRFLKDELQTIHRDVKPTNVLINQKGETKLCDFGVSGQLERSLAKTNIGCQSYMAPER
IQGERTGEVNTYTVSSDVWSLGISIIEFAIGHYPYPPETYSNIFAQLNAIVHGESPSLPS
EIYSNVAIDFVNQCLIKNPKDRPTYNDLLKHPFLREEAKNHVDMVAWVAAAIQQVKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacccaacaaaccaagctcacagtccatctcactagactcactctctctccca
ctactatcgatcacctcaccatcccaatcaccaactactaccacacaaccaacaaaccaa
ctcaacagcaacaaaaccccagcaccctcatcatcatcatcatcatcatcatcatcatca
tcagcatcatcagcagcagcagcaacagcaacaacaacagctccagatggcacaacacca
acaccaccagcatcaataccagcaacaataacagcaacaaataactcagactattcacca
tcctcatcacccagctcatcatctgctgcctcatcctcatcaatcacaaccaacacaacc
actcactctaactcaaactcaatcagcccaaccctcaccaaacaccctactggcttacca
cactcagcccaacacccacaccccccatcaaaacctgcccatcgacctcatgtgggcaac
cctggtggggtcaaggtcccacccggcttggtggccaaaatggcagcaatgaccaagcgc
aaggataaccttccatcctcctcaatgccacacaaccaaagattggatccgatggccttc
attggcgatcgtccctcggcaaacagcgccgtctcccgacctgccccgagtccatcggcc
atgctaacgccatcgatgagcacccgacgagctaagccgatgatgaaactcggtgatatg
cactctcaaccaccctcatcattatcctcctcctcctcctcatcctcgatgaacaatcag
accaagttcttgtccgtctcgggagctgccgctgcgaccccattcgctaactttagtaag
atcgtcgacccctccggcagactcaatttcggcggaaaggccatcctccattcccatggc
gtcgacttctccaacggatcctccttctctatcaatatgaacgaattgactctcatggaa
gaattgggtaaaggtaattatggtaccgtccagaaagttttccataaacctaccaaagtg
gtcatggcaatgaaagaaattagattagaattagatgattcaaagctcaaagcgattctc
accgagcttgatatcttgcatcgagcgacctcagatacgattgtcgagttctatggcgcc
ttctttatcgaatcttgtgtctactactgcatggaatatatggatggtggaagtttggat
aagttggcgggtgctgatgttccggagcccgtcctggctagagtcaccgggagggttgtt
gaagggttgcgattcctcaaggatgagttgcagactatacatcgagatgtcaagccgacg
aatgtgttgatcaaccagaagggagaaaccaagttgtgtgacttcggagtgtcgggtcaa
ctggagagatcgttagcgaagacgaacatcggatgtcaatcgtacatggcgccggagcgg
atccagggggaacggacgggagaagtgaatacgtatacggtttcctcggatgtgtggtcc
ttagggatctcgatcatcgaatttgcgatcggtcattacccttatcctcccgaaacttac
tcaaatatctttgcccaacttaatgcgatcgttcatggagaatcgcctagtcttccgtct
gagatctattcgaatgtggcgatcgatttcgtcaatcaatgtttgatcaaaaatcctaaa
gatcgtcctacttataatgatctcctcaaacatcctttcctccgtgaggaagcgaagaat
cacgtcgatatggtcgcgtgggttgctgctgctatccaacaggttaagaagtaa

DBGET integrated database retrieval system