KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0363Help
Entry
PGTDC60_0363      CDS       T01516                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00052  Galactose metabolism
pgt00561  Glycerolipid metabolism
pgt00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGTDC60_0363
  Lipid metabolism
   00561 Glycerolipid metabolism
    PGTDC60_0363
   00600 Sphingolipid metabolism
    PGTDC60_0363
Enzymes [BR:pgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PGTDC60_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase
Motif
Other DBs
NCBI-ProteinID: BAK24532
Position
383705..385009
Genome map
AA seq 434 aa AA seqDB search
MDREWTFKIPYLGSRPTHWAIKRLPEGFTFDSHEGIIRGRASSHIVFEFEISAANESGAD
SCIWQVEVSRYNGLAPVMGWSTRWLKEKEINEQTILDVADAMQSKGLVAAGYNHIIIESH
WQTSVRDSDGRIKADPLRFPNGIKHLADELHRRGMRLGLSSNASPLNVHGLSGSFEKEAI
DAATFSEWGVDFIKYDYCCSPPISIVAQQRYGAMGRALAATGRPPFFSVCEWGELMPWSW
GITVRAGSWRTSFDIQDKWKAGRYSKRDNGIWDAAMINLRYAQHANRGRAISDPDLLLIG
SPSNGCTAEEYHAQMQMWAMMRAPLVFAADPRSVSAEAVALLTHPDLIAVDQDASFRNIV
EECRADGTHLWTRQLTKGTAVLVVNAGESPTTTSIASRPDSSSAWDVSRAAYVSPSDLER
IILSPHAARLFIFE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgaatggaccttcaagataccttatctgggatcacgccccacgcattgggct
atcaagcgtttgcccgaaggatttacattcgattcccacgaaggaattattcgcggtagg
gcttcttctcacatcgtattcgaatttgaaatatcggcagccaacgaatcgggtgccgac
agttgcatttggcaagtggaagtgagtcggtataatggattggctcccgttatgggttgg
agtacacgttggctgaaggagaaagaaataaacgagcagactattttggatgtggccgat
gcgatgcaaagtaaaggactggttgcagccggatataaccatatcatcatagaaagccac
tggcaaacgtccgtacgtgatagcgacgggagaataaaggcagatcctttacgtttcccc
aatgggatcaaacatttggccgatgaactgcatcgtcggggcatgcggctcggcctttcc
tccaatgcatctcctcttaacgttcatggcttgagcggtagttttgagaaagaggcgata
gatgccgccacattctctgagtggggtgtggattttatcaaatacgactactgctgttca
ccgcctatatccatcgttgcgcagcaacggtatggtgccatggggcgtgcacttgcggca
acgggacgtcctccgttcttctccgtatgcgaatggggtgaattgatgccctggtcttgg
ggcataacggtgcgtgccggcagttggcgtacctctttcgacattcaagacaagtggaaa
gctggtcgatattctaaacgcgacaatggtatttgggatgcagcaatgatcaatttgcgc
tacgctcagcatgccaatcgtggccgcgcgatctccgatccggatctgctattgatagga
agcccctccaacggttgtacagcggaagaataccatgcacaaatgcaaatgtgggcgatg
atgcgcgctccgctggtctttgctgctgatccgcgctccgtatcggcggaggcggtagca
ctgctgacgcatcccgatctgattgcagtcgatcaggatgcttctttccgtaatatcgtg
gaggaatgtcgtgctgacggtacacatttgtggacacgtcagctgacgaaaggaacggcc
gtcttggttgtgaatgcaggagaaagcccgacgacaacgagcatcgcttcacgccccgac
tcatcatctgcgtgggacgtatcgcgagctgcttatgtgtcgccgagcgacttggaacga
atcatcctgtcgccgcacgcagcccgactgtttattttcgaataa

DBGET integrated database retrieval system