KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0564Help
Entry
PGTDC60_0564      CDS       T01516                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgt00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pgt00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgt00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pgt00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591844..592803
Genome map
AA seq 319 aa AA seqDB search
MEKPYVLGVDVGGTNTVFGVVDARGNLVISSSIKTGAHNDLNDYIKDLTAGINQLIEQVG
GKEKIKGIGVGAPNGNYYTGSIEFAPNLPWKQTKIPFAQMLTDSLGIPTTLTNDANAAAI
GEMTYGAARGMKDFIVITLGTGVGSGIVVNGSLVYGHDGFAGELGHMIVRRNGRMCGCGR
QGCLETYTSATGVARTTREYLDIRSDKSLLRNIQPDLITSKDVYDAAISGDGLAQEIFET
TGAILGEAFADFVTFSSPEAIILFGGLTKAGDLLMNPIRHHMEKNVLNIYRGKTKLLFSQ
LKESDAAVLGASALGWEAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccttatgtattaggagtggatgtaggcggtaccaacaccgtattcggagtg
gtggacgctcgtggcaatttggttataagttcgtccatcaagaccggagcgcacaacgat
ctgaacgattatatcaaagatctgactgccggcatcaatcagttgatcgaacaggtagga
gggaaagagaagataaagggtatcggtgtaggtgctcccaatggaaactattataccgga
tcgatcgagtttgcgcccaatttgccttggaaacagaccaaaatacccttcgcccaaatg
ctcaccgattcattaggtatccccacgacactgaccaatgatgccaatgctgctgccatc
ggagagatgacctatggagcagctcgtggcatgaaggacttcatcgttatcacgcttggt
acgggggtcggaagcggcatagtagtcaatggcagcttggtgtacggacacgatggattt
gccggtgagctgggacacatgatcgttcgccgcaatggtcgcatgtgcggttgtggcagg
cagggctgtctcgagacttacacctctgctacaggagtagcccgtacaactcgcgaatat
ctggacatccgttcggacaagagcttgctccggaacattcagcccgatctgatcacttcg
aaagatgtttacgatgcagctatcagtggcgatggccttgctcaagagatattcgagact
acgggagccatcctcggagaggcttttgccgacttcgttacattctccagtccggaagcg
atcatcctcttcggtggtctgaccaaagcaggtgacctgctgatgaatccgatccgccac
cacatggaaaagaatgtgctgaatatctaccgagggaagaccaagctgctcttctctcag
ctcaaagagagcgatgccgctgtgctcggggcaagtgctttgggatgggaggcaaaataa

DBGET integrated database retrieval system