KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0564Help
Entry
PGTDC60_0564      CDS       T01516                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGTDC60_0564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_0564
   00052 Galactose metabolism
    PGTDC60_0564
   00500 Starch and sucrose metabolism
    PGTDC60_0564
   00520 Amino sugar and nucleotide sugar metabolism
    PGTDC60_0564
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGTDC60_0564
   00524 Butirosin and neomycin biosynthesis
    PGTDC60_0564
Enzymes [BR:pgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGTDC60_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591844..592803
Genome map
AA seq 319 aa AA seqDB search
MEKPYVLGVDVGGTNTVFGVVDARGNLVISSSIKTGAHNDLNDYIKDLTAGINQLIEQVG
GKEKIKGIGVGAPNGNYYTGSIEFAPNLPWKQTKIPFAQMLTDSLGIPTTLTNDANAAAI
GEMTYGAARGMKDFIVITLGTGVGSGIVVNGSLVYGHDGFAGELGHMIVRRNGRMCGCGR
QGCLETYTSATGVARTTREYLDIRSDKSLLRNIQPDLITSKDVYDAAISGDGLAQEIFET
TGAILGEAFADFVTFSSPEAIILFGGLTKAGDLLMNPIRHHMEKNVLNIYRGKTKLLFSQ
LKESDAAVLGASALGWEAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccttatgtattaggagtggatgtaggcggtaccaacaccgtattcggagtg
gtggacgctcgtggcaatttggttataagttcgtccatcaagaccggagcgcacaacgat
ctgaacgattatatcaaagatctgactgccggcatcaatcagttgatcgaacaggtagga
gggaaagagaagataaagggtatcggtgtaggtgctcccaatggaaactattataccgga
tcgatcgagtttgcgcccaatttgccttggaaacagaccaaaatacccttcgcccaaatg
ctcaccgattcattaggtatccccacgacactgaccaatgatgccaatgctgctgccatc
ggagagatgacctatggagcagctcgtggcatgaaggacttcatcgttatcacgcttggt
acgggggtcggaagcggcatagtagtcaatggcagcttggtgtacggacacgatggattt
gccggtgagctgggacacatgatcgttcgccgcaatggtcgcatgtgcggttgtggcagg
cagggctgtctcgagacttacacctctgctacaggagtagcccgtacaactcgcgaatat
ctggacatccgttcggacaagagcttgctccggaacattcagcccgatctgatcacttcg
aaagatgtttacgatgcagctatcagtggcgatggccttgctcaagagatattcgagact
acgggagccatcctcggagaggcttttgccgacttcgttacattctccagtccggaagcg
atcatcctcttcggtggtctgaccaaagcaggtgacctgctgatgaatccgatccgccac
cacatggaaaagaatgtgctgaatatctaccgagggaagaccaagctgctcttctctcag
ctcaaagagagcgatgccgctgtgctcggggcaagtgctttgggatgggaggcaaaataa

DBGET integrated database retrieval system