KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0670Help
Entry
PGTDC60_0670      CDS       T01516                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707436..708503
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFASCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIVYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARYYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCSRCVSPKTGIVLDVYSSEPGMQVYTGNWMSG
KLRGKFDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttgcctcctgcctgaatggtaaggac
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gcccgaatcgttgccctcatcgtgccggacaaagacggcaatcggacggacgtcgtcctg
gggcacgactccctgcaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcgtttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctacggcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggtattatctccccacagacgataccgccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcagccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattcctccgaaccgggtatgcaggtgtacacgggcaattggatgagcgga
aagctgagggggaagttcgaccggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system