KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0710Help
Entry
PGTDC60_0710      CDS       T01516                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751785..752630
Genome map
AA seq 281 aa AA seqDB search
MKRKTLNLGGRLFSLEKPVVMGIMNITPDSFYSGSRLSSVDSVRSRAREIVEEGGALIDV
GAYSSRPNADHISAQEEMERLRPALKVLRDEFSDMPVSVDTFRADVAKMCVEEYGVAIVN
DISGGQLDGDMFRTVAALQVPYILMHMHGTPATMQSLTDYEDIAVDILDYFVERVGELRG
LGLHDIILDPGYGFSKTLEQNYELLSRQEETFGELELPILVGISRKSMIYKLFGTTPEEA
LNGTTALNMYSVMHGADILRVHDVREAAEVCRIADKLGVVK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaagactctcaacctcggcggcaggcttttcagcctggaaaagcccgtcgta
atgggcattatgaatatcacccccgattctttttactccggcagccgcctctcgagcgtg
gacagtgtgcggagtcgggcacgcgaaatcgtcgaagaaggaggggccttgatcgacgtc
ggtgcttattcctcacgtcctaatgcggatcacatatcggcacaggaggaaatggagcga
ctgcgcccggcactgaaagtattgcgggatgagttttcggacatgccggtatcggtggat
accttccgtgccgatgtggcgaagatgtgcgtagaagagtacggggtagccatcgtcaac
gatatttccggcggacagctcgacggcgatatgttccgcacggtggcggctttgcaagtg
ccctatatcctgatgcacatgcacggcacaccggctacgatgcagagcctcaccgactac
gaagacattgcggtagatatactggattacttcgtggagcgtgtcggagagctgcgcgga
ttgggtctgcacgacattatcctcgatccgggttatggtttcagcaagacgctggagcag
aattacgaattgctatcgcggcaggaggagactttcggcgagctggagcttcccatcctg
gtcgggatctcgcgcaagagtatgatctacaaactattcggcaccactccggaggaagct
ctcaacggtaccacggcactgaatatgtacagtgtcatgcatggggcggacattcttcgg
gtgcacgatgtacgggaagcggcggaagtatgccgtatagccgacaaactcggcgtcgtc
aagtaa

DBGET integrated database retrieval system