KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0817Help
Entry
PGTDC60_0817      CDS       T01516                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pgt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851229..852920
Genome map
AA seq 563 aa AA seqDB search
MKRIKQTLSTILLFIIVLSPALYAGQPREVKPVRNVILMIPDGTSLSAVSLARWYQRYLN
PDRRHLAIDPYICGTVLTYSSDAPIGDSAPTTSCYMTGMPSNTGFVSTYPVSSGDADLIP
VDKARAYSPLATFLEAAKIMKGKKTGLVVTCHFPHATPADCSAHSYSRKKYDWIAAQMVH
QNLDVVLGGGTHYLHPELQSVLNSRGYGLFLDDLNGMRTYAGDKMWALFGKREMPYDLDR
DTTQIPSLEEMTRLAIEKLNRSEEGFFLMVEGSKVDWAAHANDPVGIATEYLAFDRACAV
AFDFARRDGQTAVIIVPDHGNSGVSIGKQSVKDYDKRSAKDLFDQLCRFRLTADGLAGRL
ADTPADKVQGLVSNICGFELDAKELEALYNCPDYNHSPIPKEQRRQTEESLYSGSLSTFI
ASLYTKHTSIGFTTHGHTAEEVLLAAYHPQDTRPMGMVINYELNDYLCRLFELGSQLPVL
TDKIFAPHTEVFQGMSYSIKDGKKEGELPVLEVKKGSYRLLASPFSNTVIFNKKAIDLSS
VVVYVDKTKTFYLPRELRSLFGE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcaaacaaactcttagtacgattcttctttttattatcgtactctctccg
gctctatatgccggtcagccacgggaggtcaagccagttcggaacgtgattctgatgatt
cccgatggtacctctctttcggctgtttctctggctcgctggtatcaacgatacctgaat
cccgaccgccggcatttggctatagatccatatatatgtggtactgttctgacctattcg
tccgatgccccgattggagactctgctcctactacctcgtgctatatgacaggtatgcca
tccaatacgggttttgtgtcgacttatcctgtcagttcgggtgatgcagatctgattccg
gtggataaggctcgtgcttattctcctttggctacttttctggaggcggctaaaataatg
aagggaaagaaaacgggtttggtcgtgacttgtcacttccctcatgccacaccggccgat
tgctcggcacactcttattctcgtaagaaatacgattggattgcagcgcagatggtacac
caaaatctggatgttgtactcggaggcggaacgcactacctccatccggaactgcaatcc
gtactcaatagccgtggctatgggctctttctggatgacctgaatggaatgcgcacttat
gcgggagataagatgtgggctttgttcggcaaacgagaaatgccctatgatttagatcgt
gatactacacaaatcccttcactggaggagatgactcgcttggctatagagaagctgaat
cgttctgaggagggctttttccttatggtcgagggtagtaaagtggattgggctgcacat
gccaacgatcctgtggggattgctaccgaatatcttgctttcgatcgtgcttgtgccgtg
gcattcgactttgcccgtcgtgacggacaaacggctgtcatcatcgtgccggatcatggc
aatagcggtgtaagcataggcaaacaaagtgtgaaagactatgataagcgttctgcaaaa
gaccttttcgatcaactctgtcgcttccgcctgacagcagacggacttgcagggcgtttg
gctgatactcccgccgacaaggtccagggtttggtaagcaatatctgcggattcgaattg
gacgccaaagagttggaagctctttataattgtccggattataatcatagtcctatcccc
aaagagcagcgcaggcagacggaagaatccctctacagcggttcgctcagtaccttcatc
gcatcgctttatacgaagcacacttcgatcggttttacgacgcacggacatactgccgaa
gaagtattgttggcggcctatcaccctcaagatacacgcccgatgggaatggtcataaac
tatgaactgaatgactatctctgccgtctcttcgaattaggaagccaattgcccgtcctt
accgacaagatatttgctccccatacggaagtattccaaggcatgagctacagtatcaaa
gacggaaaaaaggaaggagaactgcctgttcttgaagtgaaaaaaggtagctatcgctta
ctggcgagtcctttctccaatacggttatcttcaataagaaagcgattgatctgtcttcc
gtagtagtctatgtagataagactaagactttctatttgcctcgtgaactgcgttcttta
ttcggagaataa

DBGET integrated database retrieval system