KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1631Help
Entry
PGTDC60_1631      CDS       T01516                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pgt00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1691750..1692316)
Genome map
AA seq 188 aa AA seqDB search
MTKLIIISAPSGTGKSTVIERLLTDRELNLHFSISATSRAPRGEEQNGREYYFLSPEEFR
RRIEANEFVEYEEVYRDKYYGTLKSEVERILKEEKNVIFDVDVVGAQSIKKYYGDRALAI
FILPPSIEELRSRLQKRGTDSMETIKQRVDKAEKEIGYAHLFDLRFVNDDLVTCVEQIRK
AIAQFLAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactaatcatcatctcggccccatccggaacaggtaagagcaccgttatcgaa
cgacttcttacggacagagagcttaaccttcatttctctatttctgcaaccagccgtgca
cctcgtggagaagagcagaatggacgagagtattacttcttgtctccggaagaattcaga
cgaagaatagaggccaacgaattcgtagagtacgaagaggtgtacagagacaaatactat
ggcacgctcaaaagtgaggtagagcggatcctgaaagaagagaaaaatgtcattttcgac
gttgatgtcgttggagcacagagcatcaagaaatattatggagatagagcattagctatc
tttattttgcctccttctatagaagagctgcgttctcgtctgcaaaaacgaggtacggac
tctatggaaactattaagcagcgcgtggacaaggccgagaaagaaatcggttatgcacat
cttttcgacctgcgctttgtaaatgatgatttggttacttgtgtggaacagataaggaag
gcgattgcccaattcttagccaaataa

DBGET integrated database retrieval system