KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1753Help
Entry
PGTDC60_1753      CDS       T01516                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1819546..1820127
Genome map
AA seq 193 aa AA seqDB search
MTEIEKEEACSRLQQHYAQVLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDPEAILR
AAMFEEDYQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARR
LQVQERLTTQIKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEEST
TREEFLNLIGRRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatagaaaaagaagaagcctgcagccgcttgcaacagcattacgcccaagta
ctgtcgttgctcggcgaagaccctaagcgtgaagggctgctcaaaactccgctacgtgtg
gctaaggccatgcagtttctgaccaaaggatataacgaggatcctgaagccatccttcgc
gcagcgatgttcgaagaagactatcagcaaatggtcatcgtcaaggacatcgatttcttt
tcgatgtgtgagcaccacatgttgccattcttcggtaaggcccatgtgggttatatcccc
aatcggtatataaccggactgagcaagttgccccgagtggtcgatgtatttgcccgtcgt
cttcaggtacaggaacggctgactacacagatcaaggagtgcatccagaatacgctgaac
cctctcggggtgatcgtcgttatcgaagcacagcacatgtgcatgcagatgcgtggagtg
gagaagcaaaactctctgactacgaccagtgactttacaggagcttttgaggaatcgacc
actcgcgaagagtttctcaatctgatcggtcgcaggcgataa

DBGET integrated database retrieval system