KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1803Help
Entry
PGTDC60_1803      CDS       T01516                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PGTDC60_1803
Enzymes [BR:pgt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PGTDC60_1803
    3.5.1.-  
     PGTDC60_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1868425..1868937
Genome map
AA seq 170 aa AA seqDB search
MVLLIVDPQVDFVSGSLAVEGAPKAMKALAEYMAAHRKEIKSIVVTMDQHPADHCSFVAQ
GGQWPSHCVRYTVGAAIEPCIAEALAACSAEGIPVEMIEKATTQERDAYSAFETEVPDSL
RSTERIVVAGIAGDYCVRQSVLDLERHGLGERIELLKEGIAYIAEEENRP
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggtacttttgatcgtggatccgcaggtggatttcgtaagcggttcgttggctgtcgaa
ggtgcaccgaaagccatgaaggctttggctgaatatatggctgcacatcggaaggagata
aagtctatcgtcgtgacgatggatcagcatccggccgatcattgcagcttcgtggcacag
ggcggacagtggccgtcgcattgtgtccgctatacggtgggagccgctatcgaaccatgc
attgcggaggctctggctgcttgttcggccgagggtatccctgtcgaaatgatagagaag
gctactacgcaggagcgcgatgcttacagtgccttcgagacggaagtacccgattcgttg
cgctcgaccgaacgtatagtcgtggccggaatagcgggcgattactgcgtgcgtcagagc
gtgctcgatctggagcgtcatggtctcggcgagcgcatcgaacttctcaaggagggaatt
gcctatatagcggaagaggaaaaccggccgtaa

DBGET integrated database retrieval system