KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1884Help
Entry
PGTDC60_1884      CDS       T01516                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTDC60_1884 (malQ)
Enzymes [BR:pgt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PGTDC60_1884 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956777..1959470)
Genome map
AA seq 897 aa AA seqDB search
MEIVFSIKYRADWGQRLCISGSSAELGNWDEALALELTATGEDRWEGRVIIDGRRKDIQY
YYLVRDAEGNAIRKEWKRMHHLVLDHGYKRVLMDDYWIDRPKNAPFFSSAFYDVFFRHEE
KLKRAPKPTKEGVKVVMQLYAPCVHPDQKICMTGNSPALGNWSVEQARAMHHLGKGEWSI
TLEKDELPPLLEYKFFIAGQDDCSDIRWEEGENRSYRFEETDAYGAVYLAGLCFREGDYM
PRYAGTVIPLFGLRTHKDWGIGDFGALRRMVDWAAMTGQRIIQLLPINDTTYTRSYRDSY
PYNIVSVIAIHPIYADLDALPRLKNSALMAKMEKQAEALRALKQMDYPAVLALKEEFLHA
LYRQEGANVMRKKAFRQFVSAAADWLDPYAAFCHLRDKYEGLPLHLWPEYTWGKNQIERM
AVSPELKTETNYYRFVQFLLHEQLHAVSAYAEEKGILLKGDIPIGVSPNSVEVWMEPSLF
DTEHAAGSPPDQFSENGQNWGFPIYRWDVMSRNGFAWWRKRFESMADYFKAFRIDHILGF
FRIWEIPVKHVSGLLGHFNPAIAMTEKEIKEYGFPFDARFCSLPLVHADDLKQIFGRYAS
EVCCRYLRPFDSDYYTLATKNFYQTDIAALDPTAVVGGEDTIRGLMRVATEVCFVIESGK
PGAFHPRIHFEKSFRYAHLSLEEKKAWQRLSDDYFYKRNDDLWKQEALSRLIPLLSSTDM
LVCVEDLGMIPPAVPVVMEQLQLLSLILERISKEPGQDFADMSRQPYCSVCTTSTHDMAP
LRLWWQENELLRRHYYSMILGEKGTAPETCTPETARRILRQHLLSTSMLAIFPLADWLSL
SGELQGIVAPEDEQINKPEISDHYWRYRMPISIESLSEDYRELNESIASLIHTSGRG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggagatagttttttcgatcaagtatcgagccgattgggggcaacgcctctgcatatcg
ggctcttcggccgaattgggaaattgggatgaagcacttgccttggagctgacagcaacg
ggcgaggacagatgggagggacgtgtgatcatagacggtcgccgcaaggatatacagtat
tactatctggtaagagacgccgaaggcaacgccattcgcaaggagtggaaacgcatgcac
catctggtattggatcatggttacaagcgagtgctgatggacgattactggatcgatcga
ccgaaaaatgcaccctttttcagttctgctttttacgatgttttcttccgccatgaggag
aagctgaaacgtgccccgaaaccaacgaaggagggcgtcaaagtcgtcatgcagctatat
gctccatgcgttcaccccgaccagaagatctgtatgacgggcaatagtcctgctcttggc
aactggtccgtggagcaagcccgtgccatgcaccatttgggaaagggcgaatggtctatc
acgctggagaaggatgaattacctccacttttggaatataagtttttcattgccggacaa
gacgactgctccgacatccgttgggaagagggagaaaacagatcttaccgattcgaagag
acggatgcctatggtgccgtctatttggccggcctatgtttccgcgagggtgattatatg
ccacgctatgccggcaccgtcatccccctattcggactgcgcacccacaaggattggggc
ataggagacttcggtgcactccgccgtatggtggactgggcggcaatgaccggccagcgc
attatacagctcctgcccatcaacgacaccacttacacacgctcctatcgcgactcctat
ccatataatatagtatcggtcatcgccatccatcctatctatgccgatttggatgcgcta
ccacgactgaagaatagtgctctgatggcaaaaatggagaagcaggccgaagcactgagg
gcactcaagcaaatggattatccggctgtgttggctctgaaggaggaatttctgcatgcc
ctgtatcgacaggaaggggcgaatgtgatgcgcaagaaagctttccgtcaattcgtctca
gcagcggccgattggttggatccatatgcggctttttgccatctgcgcgacaagtacgag
ggactgccactccatctgtggcctgaatatacgtggggaaaaaaccaaatcgaacgaatg
gcggtatctcccgaactgaaaacggagaccaattactatcgcttcgtacaatttttactc
cacgagcagctgcatgccgtatcggcctatgccgaagaaaaagggatcctactcaaagga
gatataccgatcggagtcagccccaatagtgtggaggtgtggatggaaccgtccctgttc
gacacggagcatgccgccggatcacctccggatcagttttccgagaatgggcaaaactgg
ggtttccccatctaccgatgggacgtaatgagccgaaacggctttgcctggtggcgcaag
cgtttcgagagcatggccgactacttcaaggctttccgcatagatcatatattgggcttt
ttccgtatatgggaaatccctgtcaagcatgtttcgggcttgttgggacatttcaatccg
gctatagccatgaccgaaaaggagataaaggagtacggcttcccgttcgatgcccgattc
tgctcccttccgctcgttcatgcagatgacctcaagcagattttcggacgctatgcaagc
gaagtatgctgtcgataccttcgtccgttcgattcggattattatacgctggcgacgaag
aatttctatcagaccgatatagcagcgttagatcctacagccgttgtcggaggagaggac
acgatcagaggtttgatgcgtgtagccacagaagtatgtttcgtaatagaatcaggcaag
cccggggccttccacccacgcatccatttcgaaaagtcttttcgctatgctcatctgagc
ttggaggaaaagaaagcttggcagcgtctgtcggacgactacttctacaagcggaacgat
gacctgtggaagcaagaggcactgtcgcggctgataccgctgctttcctccacggatatg
ctcgtctgtgtagaggatctgggaatgataccccctgcggtgcctgtcgtaatggaacag
ttgcaactgctatccctcattttggaaagaatatccaaagagccgggacaggactttgcc
gatatgagtcggcagccctattgttcggtatgtaccacctccacgcacgacatggcgcct
ctgcgtctttggtggcaggagaacgaactgcttcgccggcactactattccatgatcctc
ggagagaaaggtactgcaccagagacatgtacgccggagacggctcgccgaatccttcgg
cagcatctgctgtccacttccatgctggctattttcccattagccgattggctgtcgcta
tcgggtgagttgcaaggaattgttgcgcccgaggacgaacagatcaacaaaccggagatt
tccgatcactactggcgttatcggatgcctatttctatcgaaagcctttctgaagactat
cgggagctgaacgaatcgatagcctccctcattcacacctcaggcagaggataa

DBGET integrated database retrieval system