KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1909Help
Entry
PGTDC60_1909      CDS       T01516                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00010  Glycolysis / Gluconeogenesis
pgt00030  Pentose phosphate pathway
pgt00051  Fructose and mannose metabolism
pgt00680  Methane metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
pgt01120  Microbial metabolism in diverse environments
pgt01130  Biosynthesis of antibiotics
pgt01200  Carbon metabolism
Module
pgt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_1909 (fbp)
   00030 Pentose phosphate pathway
    PGTDC60_1909 (fbp)
   00051 Fructose and mannose metabolism
    PGTDC60_1909 (fbp)
  Energy metabolism
   00680 Methane metabolism
    PGTDC60_1909 (fbp)
Enzymes [BR:pgt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PGTDC60_1909 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 DUF1084
Motif
Other DBs
NCBI-ProteinID: BAK26058
Position
1982442..1984439
Genome map
AA seq 665 aa AA seqDB search
MANDKTQTVQMLKHDLDYLELLSESFPTATEVATEIINLEAILNLPKGTEHFLADIHGEY
EAFIHVLKNASGSIRRKVDEVFGGQLRQNQKRELCTLIYYPREKLELVKQSDERMEDWYM
VTLNQLIKVCQKAAEKYTRSKVRKTLPPKYSYIIQELLHEDGVNPNKSAYISSIFSSIIS
TGCADDFIIAISETIQRLVIDHLHVVGDVFDRGPGAHIIMDTLMKYHHFDIQWGNHDMLW
MGAAVGNASCMANVVRIALRYANLDTLESGYGINLLPLARFAMDTYADDPCTVFKPKLAQ
ADQTYDDKSVYLISQMHKAISIIQFKLEHQIIARHPEYKMDNRDLFHLVNFTDGTIKLSS
GVYPMLDMNFPTVDPADPYALTEQEQNIVDRLMGCFMRSEKLQNHLKCLYRHGSMYLTYN
MNLLYHASIPLNKDKSLKKVRVGDKTYAGRELLDKVEEMIRTAYVAPEKSDQRLAAVDYM
WYLWCGPDSPLFDKAMMTTFERYFIEDKATHHEEKGYYYVYRQEKAVCEMILKEFGLEGP
DTHIINGHVPVKAKKGELPIGAEGKLMLIDGGFSKAYQSSTGIAGYTLIFNSQGLHLVQH
EPFSSTRKAIEEMEDIKSITVVREVTSHRMLVKDTDNGHLLSKQVENLKKLLQAYSYGLI
KERKK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgataagacgcagaccgtgcagatgctcaagcacgatttggactatttggaa
ttgctctcggagagtttcccgacagcgacggaagtagctacggagattatcaatcttgaa
gctatattgaatctgcctaaaggaacagaacacttcctggcggacattcacggcgaatac
gaagcctttatccatgtgctcaagaatgcatccggtagtattcggagaaaggtagacgag
gtcttcggcggtcagttgcgccaaaatcagaagcgagagctgtgcaccctgatctattat
cctcgcgagaaactcgaactcgtgaagcaaagtgatgagcggatggaggactggtatatg
gtcacgctgaatcagctgatcaaagtgtgtcagaaagctgcagagaaatatactcgctcc
aaggtacgtaagacccttcctcccaagtacagctatatcattcaggagctactccacgaa
gatggtgtcaatcccaataaatcggcttatatcagcagcatcttttcctctataatatcc
acagggtgtgccgatgactttattatcgccatcagcgagaccatccagcggctggtcatc
gaccatctgcacgtggtaggggatgtcttcgaccgtggccccggagcacatatcatcatg
gatacccttatgaagtatcatcatttcgatatacagtggggcaatcatgacatgctgtgg
atgggagctgctgtgggcaatgcctcctgtatggccaatgtggtgcgtatagcactgcgc
tatgccaatttggatacattggagagcggatacggtattaacttgttgcctttggcgcgt
ttcgccatggacacttatgcggacgatccctgtaccgtatttaagcccaaactggctcag
gccgaccagacgtatgatgacaagagcgtctatctgatcagtcagatgcacaaagccata
tctatcattcagttcaagctggagcaccagatcatagcccgtcatccggagtacaagatg
gacaatcgggatttgttccatctggtgaacttcaccgatggtaccatcaagctgtcgagt
ggcgtatatccgatgttggatatgaatttcccgaccgtggatccggccgatccgtatgca
ctgacagagcaagagcagaatatcgtagatcgtctgatgggctgttttatgcggagtgaa
aaactgcaaaaccatctcaaatgcctctatcgtcatggcagtatgtacctgacgtataat
atgaatctgctctaccatgcttctatccctctgaacaaggataagtcgctcaagaaagta
cgggtaggggacaagacctatgctggacgcgaattgctcgacaaggtggaagagatgatc
cgtaccgcatatgtggctcccgagaaaagcgatcagagacttgcggctgtggactacatg
tggtacctctggtgcggaccggattctcctcttttcgacaaagctatgatgactactttc
gagcgttacttcatcgaagataaggctacgcatcatgaggaaaagggttactactacgtc
tatcgtcaggagaaagccgtttgtgagatgatcctcaaagagtttggacttgaaggccct
gatacgcatataatcaacgggcacgttccggtgaaggccaagaaaggggagcttcctatc
ggagctgaaggcaaactgatgttgatagatggcggattcagcaaggcatatcagtcaagt
acggggatcgccggctatacgctgatattcaactctcagggattgcatcttgtgcagcac
gaaccgtttagttccacacgcaaggctatcgaagagatggaggacatcaagagtatcacg
gtggtgcgtgaggtcacatcccatcgtatgctggtgaaggatacggacaatggccacttg
ctgagcaagcaggttgaaaacctcaaaaaactccttcaggcgtacagctacggactgatc
aaggaacgaaaaaaatag

DBGET integrated database retrieval system