KEGG   Meyerozyma guilliermondii: PGUG_00140Help
Entry
PGUG_00140        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_00140
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_00140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 788 aa AA seqDB search
MSSEPAARKPPEDVKNQYKKLISREFRDLQLAQDLKTKSIFDLIDYCELLYEKLVEYTDS
DSGLKAYMRGYLIFNYFINCFIMLHFQGFDKFIESNEPDFILYLNVFAFYNTKDVIRDRG
HSLSLELVRQWIIEFLTDQKLLSFDVQELYDWLYQYIDYLKQKDQEEFQSDDLRSANGVT
YAQPSIEYDRQSLNLFEERFPSVDLPSNSSPNNGSFDFISPEVKAQSFPTPPYPVNSTFT
RSPTPPYPLDDEKGVSTDDLYFSSNVQPPVQPRPKQLPPPIPNATPVQLETSYEARPYMS
SNQSFPHGYSQSAQYQRNPVPQPANHIHQPPPRGNEQYYSNHNGYTHNGHTHGRLMSRDM
GKYTICGLKNFGSTCYINLTIQLLFGLYDFSLIFENQGYLKYVKNPKYVKLLQQRHPTKD
SGLLSEAIFSLLKTFKDHPQASIAPTKFLRVSSLLKPDLNIPYEQQDSQEFLLFVLEMLH
NELGSKAFDETEWENDRIGRYMTKWGINVSPEDREPYISWYRSLLKLEGFSPIHDLFQGH
LQSKLICNKCGFESSNYSPFTILSLPIPLGHGHRVDLADCLRYYTKDEILTGENAWKCPK
CSKNISSPLSSSVLDSHPVFATKKSGLFKLGRRSKSPSKKPQNGSQTSSTTSLGSTTKKL
NFIKLPKILFMHLSRFSMTSVTDKLDTVIKYPLQITFNNNTNNSNHEITYKLTGIINHYG
TLKSGHYTALVNKSSRTSGMDSLRDPCWCFFDDEQVRIKVRHGDAADPHGEYRELNSRDV
YVLCYERV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggaaccagctgctagaaagcctccggaggacgtgaaaaatcaatataagaag
ctcattagccgagagtttcgagaccttcaacttgcacaggacctcaaaaccaaatctatc
tttgatcttatcgactattgtgaactcttatatgagaaactggtagagtacacggactcg
gactccgggttaaaggcgtacatgcgggggtatttgatattcaattactttataaactgc
ttcattatgctccattttcaaggatttgacaagtttattgaatccaacgaaccagacttc
atattatacttgaacgtctttgcattttataacaccaaagatgtgatccgagatagaggt
cattcgttgtcacttgagttggtgcgccaatggatcatcgagttcttgacagaccaaaaa
cttttgtcttttgacgtgcaagaattatatgattggctctaccagtatatcgattacctc
aagcaaaaagaccaagaagaatttcaaagtgacgacctgcgatcagccaacggagtgact
tatgctcagccctcaatagagtacgacagacagtctctcaatctgtttgaagaacgtttt
ccgtcggtggaccttccttcaaattcatcgccgaataatggttcgttcgatttcatttcc
ccagaagtaaaagcccagtcgttcccaacacctccctatccggtgaatagcaccttcaca
aggagccctacacctccttatcctttggatgatgaaaaaggtgtctcgactgatgacttg
tatttcagctcaaatgtccaacctccagtccaaccgagaccgaagcaattaccacctccc
attcccaatgccactccagttcagcttgagacgagctacgaagctcgcccgtacatgtcc
tcgaatcagtcatttcctcatggttattctcaaagtgctcagtaccagcggaaccctgtt
ccgcaacctgcaaatcatattcatcagccacctccccgcggtaatgagcagtattactca
aatcataatggttacacccataatggtcacacccacggacgtctgatgtcccgtgatatg
ggcaagtacacaatttgtggtcttaagaatttcgggtctacctgctacatcaatctgaca
atccaattgctttttgggttgtacgatttttcgttgatatttgagaatcagggttatttg
aagtatgtgaagaaccccaagtatgtcaagcttctccaacaacgacatcctaccaaggac
tcggggctcttaagtgaagcaatattcagcttgcttaagaccttcaaagatcatccgcaa
gcttccattgccccgaccaaatttcttcgggtttcttctttattaaagccggacttgaac
attccttatgagcagcaggactcccaagaattcttattgtttgtgttggaaatgttacac
aatgagcttggctccaaagcgtttgatgaaaccgaatgggaaaacgatcgaattggtcgc
tacatgacgaaatggggtatcaacgtaagtcctgaagaccgtgagccttatatatcatgg
tatcgatcacttttgaaattggaagggttctccccaattcacgatttatttcaagggcac
ttgcagagcaaattgatctgcaataaatgtgggtttgaatcgagtaactactccccattt
accattttatctttaccaatacctctgggtcatggtcatcgagtggacttggcagactgt
ttgcgttattatacaaaggacgaaatcttgactggagaaaatgcatggaaatgtcccaag
tgttcgaaaaacatctccagtccgctgtcttccagtgtgctagactcacatcctgtgttc
gcaactaaaaagagtgggcttttcaagttgggaagacgtagtaaatctcctagcaaaaaa
ccacagaatggtagccaaacttcatcaaccacatcactaggctccactacaaaaaagctc
aactttatcaagttgcccaaaatacttttcatgcatttatctcggttttctatgaccagt
gtcaccgataaattggacactgttataaagtatccattacaaattacctttaacaacaac
accaacaattccaaccacgaaatcacctataagctcaccggaatcatcaatcattacgga
acgttgaaaagtggtcattatactgcattagtgaacaagtcatctcggacttcgggaatg
gacagcttgcgagatccttgttggtgcttcttcgatgatgagcaagttcgaatcaaggtc
agacacggagacgccgccgatccacatggggaataccgggagctcaactctcgagatgtt
tatgtcttgtgttacgaaagagtttag

DBGET integrated database retrieval system