KEGG   Meyerozyma guilliermondii: PGUG_00206Help
Entry
PGUG_00206        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pgu00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:pgu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 921 aa AA seqDB search
MMLPGKPNGEYTTESDGEGNAADVEMMYVPSSSKQRAGLLPVYSNLPNQLINLRANETKG
SFNGMSDCVVTKGTIKDLVTSKDNSDLTIVSESSTFSSLNDRLEEMRLEDKEHTSSELHR
AMERYRSITPFLHGGLPLLKVSQKSRKRILLQVDPSEFKIQWKITAKASSSNGISGFQKL
LNTASAHNNKVHELPITCIKWVSLQADATSYREELHISKEFENQWLTICYLDMKKDKLKT
LHLITDTERDFKRLSGIIDTLRRVREALTNNFLLGADNITELRESLLSTPQLEGPVKEVR
ELLYLEDILKYSRRLNINLDEAFLKDVFDNVITRVATSSEPKGLSFEGFKEFVSIIKRRD
DISHIWEACFSSLSTIDFDKFCTFMIEIQKEEHNEEHLRKLFVRFSKREDRLIWTKESFN
AFLLSKYSTIFKNDFSDDYFDHPLNDYFISSSHNTYLIGRQFVGDSSIDGYIRAFQRGCK
CVEIDIWDGMSIDGDLDNNESEGIKGPIVNHGRSFTSSISLKNVLLTVKKYAFSSSSWPV
ILSLEVHCNAENQLKIKKLLKDILGESLVTDMLDNDCVLPSPRKLRSKILLKVKRTSART
YSVSQDGQSALSTSTTSTSFSEDSGAAQRRDSFSIRRRSELTKIVTELSDLAIYIQGIKF
RNFSLPESKTFNHCISLSEKSFNSLLSDEEKRLSLAKHNRKFLMRVYPSKMRIGSSNFNP
ITQWNYGVQMVASNWQTYDVGQQINEALFQSCGGTGYALKPKSLRSPLSKKRKPELVQRP
LMRFSLKIISALQLPKSKGSNAATNPFVSVEMHGCSLIQWDGESQEPSTLIIAANGFNPI
WNEQFSCIMSAENDLAFLRIVVNSSLSATGKEDIQPLGIIVLRVGCIKDGYRYLPINDPL
GEELVYSKLLVRIDKDHDIGI
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacctggcaagcccaatggagaatatactaccgaatctgatggtgaaggcaat
gcagcagatgtggaaatgatgtacgtaccatcatcctcgaagcagcgagcggggttgcta
cctgtttattcaaatcttcctaaccaattgatcaatttaagggccaatgagaccaaggga
tctttcaatggaatgagtgattgtgtcgttactaaaggcaccattaaagatttggtaaca
agtaaggataatagtgatcttacaattgtaagcgaatcttcgacattctctagtctaaat
gataggttagaagaaatgaggttagaggacaaagaacatactagttcagaactccataga
gcgatggagcgctacaggtctatcacaccatttttgcatggaggacttcccctcttgaaa
gtttcccaaaagtctcgaaagagaatcttacttcaggttgatcccagtgaattcaaaata
cagtggaaaataaccgcaaaagcatcttcatctaatggaatatcaggttttcaaaagctt
ttgaacacagcatccgctcacaacaataaggtccacgagttaccgattacttgcatcaag
tgggtctcattacaggctgatgcaactagctaccgagaagaactacacatttccaaagag
tttgaaaaccaatggctaacaatttgctacttggacatgaaaaaagataaacttaagact
ttgcatttgattacagacacagaacgcgattttaaacgactctctggcataatagacacc
ttgaggagagtgagggaagcgttgacaaacaactttctacttggggccgacaacataacg
gaattacgagaatctcttctttccactccacagctggaaggaccagtgaaagaagtgaga
gagctactatatttggaagacatactaaagtattcgaggagactaaatatcaacctcgac
gaagcttttcttaaagacgtcttcgacaacgtgataacgagagtagctacaagctctgag
cctaagggactcagctttgaaggttttaaagaatttgtttcaattatcaagcgacgagat
gacatttcacatatttgggaagcatgcttttcttctctgtcaacaattgattttgataaa
ttttgcaccttcatgatagaaatacagaaagaggaacacaatgaagagcatctaagaaaa
ctatttgtgcgtttcagtaagagggaagacaggctgatttggacaaaagagagcttcaat
gcatttttgctttcaaaatattcaacaatattcaaaaatgatttcagtgacgattacttt
gatcatcccctcaatgactatttcatatcctcatcacataacacctatctcattggaagg
caattcgtcggggactcttcaattgatggttatataagagctttccaacgtggttgcaaa
tgtgttgagatagacatctgggatggtatgtcaattgatggcgatctagacaacaatgaa
agcgaaggaattaagggcccaattgttaaccatggtcgctccttcacgtcatcgatttcc
ttaaagaacgtattactgactgttaaaaaatatgcatttagttcgtcgagctggcccgtc
atattaagcttggaagtacactgcaatgcggagaatcagctaaaaatcaagaagttgctc
aaggatatcctaggcgaatcgttggtcaccgacatgctagacaatgattgtgtgctaccc
agtcctcgcaaattgagaagcaagatacttctcaaggtcaagagaaccagtgcacgaaca
tattcagtttctcaggatggccaaagtgcactctcaacttctacgactagtacatcgttc
agtgaagatagtggtgctgctcaaagacgtgactctttttcaatacgacggaggtctgaa
ctgacaaaaattgtgacggagttgagtgatcttgcgatctatattcagggtatcaaattt
cggaatttttcgcttcccgagtcgaagacgttcaaccactgtatttcactcagtgaaaaa
agcttcaactcgttgttgagtgacgaagaaaagcgactttcacttgccaagcataatcgt
aaattcttgatgagagtatatccttcgaagatgagaattggatcatcgaattttaatcct
ataactcaatggaactatggagtacaaatggtagccagtaactggcagacttacgatgtt
ggccaacagattaatgaagcattgtttcagagttgtggaggaactggatacgctttgaaa
cccaagtctcttaggtcacctctctctaagaaacgcaaaccagagttggtacagcgaccc
ttgatgagattttcgttgaagatcattagcgctcttcagctacctaagagtaaaggatca
aatgccgcaaccaacccattcgtctccgttgaaatgcacggctgctcattaattcagtgg
gatggtgaaagccaagagccaagtacactgataattgcggctaatggcttcaatccgatt
tggaacgagcagtttagttgtatcatgtccgcagagaatgatttagcatttctcagaata
gtcgtcaactcttcgctgagcgcaacaggaaaggaggatatccagccactaggaataata
gtgcttcgagtcggctgtattaaagatggctatcgatatttacctatcaatgatcctttg
ggcgaagaactagtctactccaagttattagtgcgtatagacaaggatcacgatataggt
atttga

DBGET integrated database retrieval system