KEGG   Meyerozyma guilliermondii: PGUG_00206Help
Entry
PGUG_00206        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PGUG_00206
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PGUG_00206
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PGUG_00206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 921 aa AA seqDB search
MMLPGKPNGEYTTESDGEGNAADVEMMYVPSSSKQRAGLLPVYSNLPNQLINLRANETKG
SFNGMSDCVVTKGTIKDLVTSKDNSDLTIVSESSTFSSLNDRLEEMRLEDKEHTSSELHR
AMERYRSITPFLHGGLPLLKVSQKSRKRILLQVDPSEFKIQWKITAKASSSNGISGFQKL
LNTASAHNNKVHELPITCIKWVSLQADATSYREELHISKEFENQWLTICYLDMKKDKLKT
LHLITDTERDFKRLSGIIDTLRRVREALTNNFLLGADNITELRESLLSTPQLEGPVKEVR
ELLYLEDILKYSRRLNINLDEAFLKDVFDNVITRVATSSEPKGLSFEGFKEFVSIIKRRD
DISHIWEACFSSLSTIDFDKFCTFMIEIQKEEHNEEHLRKLFVRFSKREDRLIWTKESFN
AFLLSKYSTIFKNDFSDDYFDHPLNDYFISSSHNTYLIGRQFVGDSSIDGYIRAFQRGCK
CVEIDIWDGMSIDGDLDNNESEGIKGPIVNHGRSFTSSISLKNVLLTVKKYAFSSSSWPV
ILSLEVHCNAENQLKIKKLLKDILGESLVTDMLDNDCVLPSPRKLRSKILLKVKRTSART
YSVSQDGQSALSTSTTSTSFSEDSGAAQRRDSFSIRRRSELTKIVTELSDLAIYIQGIKF
RNFSLPESKTFNHCISLSEKSFNSLLSDEEKRLSLAKHNRKFLMRVYPSKMRIGSSNFNP
ITQWNYGVQMVASNWQTYDVGQQINEALFQSCGGTGYALKPKSLRSPLSKKRKPELVQRP
LMRFSLKIISALQLPKSKGSNAATNPFVSVEMHGCSLIQWDGESQEPSTLIIAANGFNPI
WNEQFSCIMSAENDLAFLRIVVNSSLSATGKEDIQPLGIIVLRVGCIKDGYRYLPINDPL
GEELVYSKLLVRIDKDHDIGI
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacctggcaagcccaatggagaatatactaccgaatctgatggtgaaggcaat
gcagcagatgtggaaatgatgtacgtaccatcatcctcgaagcagcgagcggggttgcta
cctgtttattcaaatcttcctaaccaattgatcaatttaagggccaatgagaccaaggga
tctttcaatggaatgagtgattgtgtcgttactaaaggcaccattaaagatttggtaaca
agtaaggataatagtgatcttacaattgtaagcgaatcttcgacattctctagtctaaat
gataggttagaagaaatgaggttagaggacaaagaacatactagttcagaactccataga
gcgatggagcgctacaggtctatcacaccatttttgcatggaggacttcccctcttgaaa
gtttcccaaaagtctcgaaagagaatcttacttcaggttgatcccagtgaattcaaaata
cagtggaaaataaccgcaaaagcatcttcatctaatggaatatcaggttttcaaaagctt
ttgaacacagcatccgctcacaacaataaggtccacgagttaccgattacttgcatcaag
tgggtctcattacaggctgatgcaactagctaccgagaagaactacacatttccaaagag
tttgaaaaccaatggctaacaatttgctacttggacatgaaaaaagataaacttaagact
ttgcatttgattacagacacagaacgcgattttaaacgactctctggcataatagacacc
ttgaggagagtgagggaagcgttgacaaacaactttctacttggggccgacaacataacg
gaattacgagaatctcttctttccactccacagctggaaggaccagtgaaagaagtgaga
gagctactatatttggaagacatactaaagtattcgaggagactaaatatcaacctcgac
gaagcttttcttaaagacgtcttcgacaacgtgataacgagagtagctacaagctctgag
cctaagggactcagctttgaaggttttaaagaatttgtttcaattatcaagcgacgagat
gacatttcacatatttgggaagcatgcttttcttctctgtcaacaattgattttgataaa
ttttgcaccttcatgatagaaatacagaaagaggaacacaatgaagagcatctaagaaaa
ctatttgtgcgtttcagtaagagggaagacaggctgatttggacaaaagagagcttcaat
gcatttttgctttcaaaatattcaacaatattcaaaaatgatttcagtgacgattacttt
gatcatcccctcaatgactatttcatatcctcatcacataacacctatctcattggaagg
caattcgtcggggactcttcaattgatggttatataagagctttccaacgtggttgcaaa
tgtgttgagatagacatctgggatggtatgtcaattgatggcgatctagacaacaatgaa
agcgaaggaattaagggcccaattgttaaccatggtcgctccttcacgtcatcgatttcc
ttaaagaacgtattactgactgttaaaaaatatgcatttagttcgtcgagctggcccgtc
atattaagcttggaagtacactgcaatgcggagaatcagctaaaaatcaagaagttgctc
aaggatatcctaggcgaatcgttggtcaccgacatgctagacaatgattgtgtgctaccc
agtcctcgcaaattgagaagcaagatacttctcaaggtcaagagaaccagtgcacgaaca
tattcagtttctcaggatggccaaagtgcactctcaacttctacgactagtacatcgttc
agtgaagatagtggtgctgctcaaagacgtgactctttttcaatacgacggaggtctgaa
ctgacaaaaattgtgacggagttgagtgatcttgcgatctatattcagggtatcaaattt
cggaatttttcgcttcccgagtcgaagacgttcaaccactgtatttcactcagtgaaaaa
agcttcaactcgttgttgagtgacgaagaaaagcgactttcacttgccaagcataatcgt
aaattcttgatgagagtatatccttcgaagatgagaattggatcatcgaattttaatcct
ataactcaatggaactatggagtacaaatggtagccagtaactggcagacttacgatgtt
ggccaacagattaatgaagcattgtttcagagttgtggaggaactggatacgctttgaaa
cccaagtctcttaggtcacctctctctaagaaacgcaaaccagagttggtacagcgaccc
ttgatgagattttcgttgaagatcattagcgctcttcagctacctaagagtaaaggatca
aatgccgcaaccaacccattcgtctccgttgaaatgcacggctgctcattaattcagtgg
gatggtgaaagccaagagccaagtacactgataattgcggctaatggcttcaatccgatt
tggaacgagcagtttagttgtatcatgtccgcagagaatgatttagcatttctcagaata
gtcgtcaactcttcgctgagcgcaacaggaaaggaggatatccagccactaggaataata
gtgcttcgagtcggctgtattaaagatggctatcgatatttacctatcaatgatcctttg
ggcgaagaactagtctactccaagttattagtgcgtatagacaaggatcacgatataggt
atttga

DBGET integrated database retrieval system