KEGG   Meyerozyma guilliermondii: PGUG_00434Help
Entry
PGUG_00434        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1685 aa AA seqDB search
MELMPLILDTFQDQSFFIQKRCSIEDTRSISKLFGLCYTASLGLFLSFWECWLAFLNWRP
PPHIRRENRSIIGYFRCLGIHTSTVRSNKIQRAFLLTKNAAPVDVAFLMQGMSPSNEEYY
PTVAINNLTKILKDPSLSMHHNKVIQAIMYIFQTLGLRCVSFLPLIIPGIINVMHTCQTS
MLKFYFQQLSALILIVRQHIRPFLPEIFAIIKEFFTLIHNPNIQIIIISLIESISRALEG
EFKMHMPEVLTLLLNVLEEDETAKREPSLHVLRSLVVFGSNTEEYIHIMVPNIVKLFEVG
PIVLRKAAIETIGRLSKTVLLNDMASRIIHPILRVLQQGSDELKVTAMNTLSYLLLQLGT
EFSVFIPVIKKVLVQQKIHSNTFEQLVTKLLSGDPLPTHLNIYKDYDIHLNFDPTDVDMP
SKKLPVNQSALKAAWDSSQRRTKEDWQDWISRLSKELLKQSPSHAIRACAGLASDYYPLA
KDLFNASFASCWSELYSQHQEELVESFCIALSSPNNPPEIHQILLNLAEFMEHDDKSLPI
AITVLGQYAQRCHAYAKALHYKELEFYEEPSTPTIESLISINNQLQQSDAAVGILKHAQL
HHDLQLKETWYEKLQRWDDALRAYNERQISEPDNMDVVMGKMRCLHALGEWEQLSELAQS
KWNNSSSDTKRMVAPLAAAAAWGLGQWDRMDTCIQVMKSESPDKAFFNAILSLHRNNFED
ASNHILVARDLLVTEITALVSESYNRAYGVVVRVQMLAELEEIIKYKCLPRGSEKRAIMR
KTWNTRLLGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFANLCRKSGRLNLAEKSLNYL
LEEGFPENPSKAPPQVVYAQIKYMWAKGQQREALRHLVDFTARMSQDLGLNPNDLITQPL
PSEAPGIPKHVEEYTRLLARCFLKQGEWQIALNSNWRNDTSEIILGAYLLATHFDTKWYK
AWHNWALANFEVISLYTTQRTNSTKDTSVQDDIMPQNGTLGAEDEAGKGQNKAAGPSAPQ
SNIIPMEIVQRHVVPSIKGFFHSIALSTASSLQDTLRLLTLWFKFGGISEAAKAMTDGFN
MVKIDKWLEVIPQLISRIHQPNEVVSRSLFGLLTDLGKAHPQALVYPLAVAVTSESVNRQ
RAALSIIDQMRLHSPVLVDQSELVSHELIRVAVLWHEQWYEGLEDASRLFFGEHNTDKMF
EVLEPLHQMLQKGPETLRESSFANAFGRELADAYEWVLNFRRTKDITNLNQAWDVYYNVF
RRISRQLPQLQTLELQYVSPKLEEATDLELAVPGTYEPGKPVVRIAKFDPSLTVISSKQR
PRKLTCRGSDGKDYSFALKGHEDIRQDNLVMQLFGLVNTLLVNDPECFKRHLDIERSPAI
PLAPKVGLFGWFPHSDTFHVLIKEYRESRKITLNIEHRIMLQMAPDYDSLTLLQKVEVFM
GALDNTRGQDLYKVLWLKSKSSETWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDR
ITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLR
DNKESLMAILEAFAYDPLINWGFDFPTKAMAEATGIEVPQVNVAELLRRGQIDEAEAVKL
TKQNDVEIRNARAALVLKRITDKLTGNDIKRLHGLDVPTQVDKLIQQATSVENLCQHYIG
WCSFW
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atggaattaatgcctttgattttagacactttccaagaccagagcttcttcattcaaaag
agatgcagcattgaagacactcggtcaattagcaagctcttcgggttatgttatacagcc
tctcttggacttttcctcagcttttgggaatgttggttggcattcttaaactggagacct
cccccacatattcgtcgagaaaaccgttcgattattgggtattttaggtgccttgggatc
catacaagcaccgtgaggtcgaacaaaattcaaagagcatttcttctgaccaaaaatgct
gccccagtagatgtggctttcttgatgcagggaatgtctccttcaaatgaagagtactac
ccaacggttgccataaacaatttgaccaaaattttgaaagatccctctttgagcatgcac
cacaacaaggtgattcaagcaataatgtatatctttcaaacactcggactcagatgtgtt
tcattcttgccactaattataccaggaatcatcaacgttatgcatacttgccagacatcg
atgttgaaattctactttcagcaacttagtgccctcattctaatcgtgaggcagcatatt
cgtccatttttaccagaaatctttgccatcatcaaggaatttttcaccctgattcacaat
cctaatatccaaatcataatcatctccctcatcgagtccatctcgcgtgcattggaaggg
gagttcaaaatgcacatgccagaagttttgacgttacttttgaatgttcttgaagaagat
gagaccgccaagcgtgagccttccttacatgtgttgcgaagcttagttgtattcggaagc
aacactgaggaatatatacatatcatggttccaaatatcgtcaagttgttcgaagttggt
cctatagtgttgcgtaaagccgcgattgaaactatcggtagactttcgaaaacagttctg
ttaaacgatatggcttcaagaataatccatccaatattgcgagtcttgcaacaaggaagt
gatgagctaaaagtcacggcgatgaacaccttgagttatttactattgcagcttggcaca
gagtttagtgtgtttattccagtcatcaagaaggttttagtccagcaaaagattcactcc
aatacttttgaacagttggttacaaaactcttgagtggagatccattacccacacatctc
aacatctacaaagactatgatatccatctgaattttgatccaaccgatgtcgacatgcct
tccaagaaacttcctgtcaatcagtctgctttaaaggctgcttgggactcgtcacaaaga
agaaccaaggaagattggcaagattggataagccgtttgagtaaggaacttttgaaacaa
agtccttcgcatgcaatcagagcatgtgctggattagcttccgattattacccattagca
aaggatttattcaatgccagttttgcaagttgttggagtgagctttattcacaacatcag
gaagagcttgtggaatcgttttgtatcgcattgtcgtcaccaaataatcctcctgaaatt
catcaaattttgttgaatttggcagagtttatggaacatgacgacaagtcattacctata
gcaatcactgttttgggccaatacgctcaacgatgtcatgcttatgccaaagcgttgcat
tacaaggagcttgaattctatgaggaaccgtctacaccaactattgagtccttgattagt
atcaataatcaattacagcaatctgatgccgcagttggtatattaaagcatgcacaattg
caccatgatctccaacttaaggaaacatggtatgaaaagctacagcgttgggacgacgct
ttaagagcttataatgaacgacagatatcagagcctgataatatggatgtcgtcatgggt
aaaatgagatgtttgcatgctcttggagaatgggaacagttatctgaattggcgcagagc
aaatggaataactcgtccagtgacaccaagagaatggttgcaccgttagcagcagctgct
gcatggggtttgggtcaatgggaccgaatggatacctgtatccaagtcatgaaatccgaa
tctcctgataaagcatttttcaatgccattcttagtttgcacagaaacaactttgaagat
gcatcgaatcatatattggttgcaagagacttgttggttactgaaataacagcgcttgtc
agcgaaagttacaatagagcatatggagtcgttgtcagagttcaaatgcttgccgagtta
gaggagattatcaagtataaatgcttgcctcgaggttctgaaaagcgtgcaattatgaga
aagacatggaacaccaggttgctaggatgtcaacgtaatgtcgatatctggcaacgtatg
cttaaagtgagggccttagtgatcaagcccaagcaggatatggatatgtggatcaaattt
gccaatttatgtcgaaagtcgggccgtcttaatttggctgagaaatctctcaactatttg
ttggaggaggggttccctgaaaatccttctaaggctccaccacaagtggtttatgctcag
ataaagtacatgtgggctaagggacaacaacgagaagcactccgccatttggttgatttc
acagctcgtatgtcgcaagacttgggtttgaatccaaacgatttgatcacccaacctcta
ccttctgaagcgccaggtattccaaagcatgtggaggagtacacaagactccttgccagg
tgtttcttgaagcaaggggaatggcagattgctttaaatagcaactggagaaacgatact
tccgaaatcattttgggagcgtaccttttggctactcatttcgataccaagtggtacaag
gcttggcacaactgggcgctagcaaattttgaagtcatctcgctgtacaccacccagcgt
acaaattccacaaaggatactagcgttcaagatgacatcatgcctcaaaacggaactctt
ggtgctgaagatgaagctggtaagggtcaaaataaggcagctggtccttccgcaccacag
tccaatattatcccaatggaaattgtgcaaaggcatgtggttccttcaatcaaaggtttc
tttcattccattgctttatccaccgctagctcgttacaagatactttgcgtttgttaacc
ttatggttcaaatttggtggaatcagtgaagctgcgaaggctatgactgatggtttcaat
atggtcaagatcgataaatggttggaagtgataccacaattgatctcgagaattcatcag
cctaacgaggttgtgagtaggtccttatttggtcttctcacagatctaggcaaagctcat
ccacaggcgcttgtatatccacttgcagttgcagtgacttctgagtctgttaacaggcag
cgtgcagcgttgtcgattatagaccaaatgcgtttacactctcctgtcttagtcgatcaa
tcagaacttgtcagtcatgaactaattcgtgttgctgttttatggcacgaacaatggtat
gaaggactagaagatgcatcgaggttgttctttggtgaacacaatactgataagatgttc
gaagttttggagcctctacatcaaatgcttcaaaaggggcccgaaactttgagggaatct
tcgtttgcaaatgcgttcgggagggagttggcagatgcctatgaatgggtgttgaacttc
cgtcgtaccaaggatatcaccaacttaaatcaagcttgggatgtctactacaatgtgttc
cgtcgtattagcaggcaactcccacaactccaaacattggaacttcaatacgtttcacca
aaattagaagaggcaacggatcttgaattagccgttccaggtacctacgaacctggtaaa
ccagtggtacgcattgccaaattcgatccttccttgacggttatatcttcgaaacagaga
cccagaaaacttacttgcagaggaagcgatggtaaagattattcgtttgccttgaaagga
catgaagatatcagacaggataaccttgttatgcaattatttggtctagtcaatacctta
ttggttaacgatccggaatgttttaaacgacatctcgatatcgagaggtctccagctatt
ccccttgctccaaaggttggtctctttggctggttcccacacagtgatactttccatgtt
cttatcaaagagtatcgtgaatcgagaaagatcaccttgaacattgaacatcgaatcatg
ttgcagatggctcctgactatgacagtttaactttgttgcaaaaggttgaagtcttcatg
ggtgctctcgataataccagaggtcaagatttgtataaggtgttgtggttgaagtccaag
tcttcggaaacttggttggaccgtcgtactacatatacccgctccttggcagtcatgtct
atggtgggttatatccttggtttgggagacagacatccttccaacttgatgcttgaccgt
ataaccggtaaagtgattcatattgattttggtgactgtttcgaagcggctatactacgt
gaaaagtatcccgaaaaagtgccatttaggctcacaaggatgctcaattatgctatggaa
gtgagcggtatagagggctcattcagaatcacatgtgagcatgtaatgcgtgtgttgaga
gataacaaagagtccttgatggccattttggaagcttttgcttatgatccgttgatcaat
tggggttttgacttccctacaaaagccatggctgaagcaacaggtattgaggttccacaa
gtcaatgtggcagaacttcttcgtcgtggacagattgatgaagctgaggctgttaaactc
acgaagcagaacgatgttgaaattcgtaacgctcgagcagcgttggtattaaagagaatt
actgataagcttaccggaaatgatatcaaaaggctccatggtttggatgtacctactcaa
gtcgacaagcttatacaacaagcaactagcgtcgaaaacttgtgccagcactacattgga
tggtgttcgttctggtag

DBGET integrated database retrieval system