KEGG   Meyerozyma guilliermondii: PGUG_00452Help
Entry
PGUG_00452        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pgu  Meyerozyma guilliermondii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PGUG_00452
   03420 Nucleotide excision repair
    PGUG_00452
   03430 Mismatch repair
    PGUG_00452
   03440 Homologous recombination
    PGUG_00452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MTDLGYGNFGDGGFSDTATGGFQADVDGSQKPQQTRSSITPVTIKQVIQAVALGPDLDFR
INNVELNMVRVIGVLRKVDTNASAVNLTIEDGSGSMEVRKWTDETASAAEAEKYSLYLNQ
YVSVSGALKEFNNKKGIQQATIRPILDHNQVIYHHLSAISHHLKAQGLHVRRKPENENGL
FVSENGGGDSLQERVLQVINELTPSMQEGVPLQLIAQKVNATDDSVENECQELVQSGRIY
LTYDDRTYLGL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttaggatacggaaactttggagatggcggattttccgatactgcaacggga
gggttccaggcagacgtagatgggtctcaaaagccgcaacaaactcgttcaagtattact
cccgtgacgataaaacaagtgatccaggcagtggctttgggaccagatcttgatttccgc
atcaataacgtggagttgaacatggttcgtgtgattggagtgctcagaaaggtggacacg
aatgcctcggccgtgaatcttacgattgaagatggttctggttcgatggaggtgcgtaag
tggactgatgaaaccgcgtctgctgccgaagcagagaaatactcgctgtacttgaaccag
tatgttagcgtgagcggagcattgaaagagttcaacaacaagaagggaatacaacaggct
accattcgacccatactggaccataatcaagttatatatcaccacttgagtgccatcagc
caccacttgaaggcacagggcttgcacgtgcgtaggaagccagagaacgaaaatggacta
tttgtttctgaaaatggaggaggtgattcgttacaggaaagagtgcttcaggttattaat
gaactcactccctcaatgcaagaaggtgtccccctccaattaattgcccagaaagtcaac
gccactgatgacagcgtcgaaaacgaatgccaggagttggtacagagcggaagaatctac
ctgacttatgatgacaggacttacttgggtctttag

DBGET integrated database retrieval system